SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000010226 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000010226
Domain Number 1 Region: 285-649
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.8e-62
Family Quinoprotein alcohol dehydrogenase-like 0.027
Further Details:      
 
Domain Number 2 Region: 30-228,280-370
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 3.14e-24
Family SGL-like 0.044
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000010226
Domain Number - Region: 582-633,688-731
Classification Level Classification E-value
Superfamily Peptidase/esterase 'gauge' domain 0.00136
Family Prolyl oligopeptidase, N-terminal domain 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000010226   Gene: ENSCJAG00000005570   Transcript: ENSCJAT00000010810
Sequence length 918
Comment pep:known chromosome:C_jacchus3.2.1:21:47930571:47956179:1 gene:ENSCJAG00000005570 transcript:ENSCJAT00000010810 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKFAYRFSNLLGTVYRRGNLNFTFDGNSVISPVGNRVTIFDLKNNRSDTLPLATRYNIQC
VGLSPDGRLAIIVDEGGDALLVSLVCRSVLHRFHFKGSVHSVSFSPDGRKFVVTKGNIAQ
MYHAPGKKREFNAFFLDKTYFGPYDETTCIDWTDDSRCFVVGSKDMSTWVFGAERWDNLI
YYALGGHKDAIVACFFESSSLDLYSLSQDGVLCVWQCDTPPEGLRLKPPAGWKADLLQRE
EEGEENQEGDRETTIQGKATPAEEEKTGKVKYSRLAKYFFNKEGDFNNLTAAAFHKKSHL
LVTGFASGIFHLHELPEFNLIHSLSISDQSIASVAVNSSGDWIAFGCSGLGQLLVWEWQS
ESYVLKQQGHFNSMVTLAYSPDGQYIVTGGDDGKVKVWNTLSGFCFVTFTEHSSGVTGVT
FTATGYVVVTSSMDGTVRAFDLHRYRNFRTFTSPRPTQFSCVAVDASGEIVSAGAQDSFE
IFVWSMQTGRLLDVLSGHEGPISGLCFNPMKSILASASWDKTVRLWDMFDSWRTKETLAL
TSDALAVTFRPDGAELAVATLNSQITFWDPENAVQTGSIEGRHDLKTGRKELDKITAKHS
AKGKAFGTLCYSADGHSILAGGMSKFVCIYHVREQILMKRFEISCNLSLDAMEEFLNRRK
MTEFGNLALIDQDAGQEDGVAIALPGVKKGDMSSRHFKPEIRVTSVRFSPTGRCWAATTT
EGLLIYSLDTRVLFDPFELDTSVTPRRVREALRQQDFTRAILMALRLNESKLVQEALEAV
PRDEIEVVSSSLPELYVEKVLEFLASSFEVSRHVEFYLLWTQKLLMLHGQKLKARATTLL
PVIQFLQKSIQRHLDDLSKLCGWNRYNMQYALAVSQQRGTKRPLEPLGSEEEEAEASEDN
SLQLLGGAGRDSEEEMLA
Download sequence
Identical sequences F6V9M8
XP_002761514.1.60252 ENSCJAP00000010226 ENSCJAP00000010226

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]