SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000010659 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000010659
Domain Number 1 Region: 25-185,399-687
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 3.53e-70
Family Quinoprotein alcohol dehydrogenase-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000010659   Gene: ENSCJAG00000005749   Transcript: ENSCJAT00000011259
Sequence length 945
Comment pep:known chromosome:C_jacchus3.2.1:7:154119709:154524689:1 gene:ENSCJAG00000005749 transcript:ENSCJAT00000011259 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLTKQYLRYVASAVFGLIGSQKGNIVFVTLRGEKGRYVAVPACEHVFIWDLRKGEKILI
LQGLKQEVTCLCPSPDGLHLAVGYDDGSIRIFSLLSGEGNVTFNGHKAGITTLKYDQLGG
RLASGSKDTDIIVWDVINESGLYRLKGHKDAITQALFLREKNLLVTSGKDTVVKWWDLDT
QHCFKTMVGHRTEVWGLVLVSEEKRLITGASDSELRAWDITYLQEIEDLEEPKPKKIRGS
SPGVQDTLETEDGALETDGAPEDRIVSCRKAGSIMREGRDRVVNLAVDKTGRILACHGTD
SVLELFCILSKEEIHKKMDKKMKKARKKAKLNSCKGEEEDPEINVEMTLQDEIQRVTNIK
TSAKIKSFDLIHSPQGELKAVFLLQNNLVELYSFNPSLPTPQPVRTSRITIGGHRSDVRT
LSFSSDNIAVLSASADSVKIWNRSTLQCIRTMTCEYALCSFFVPGDRQVIIGTKTGKLQL
FDLASGNLLETIDAHDGALWSMSLSPDQRGFVTGGADKSVKFWDFELVKDENSTQKSARL
SVKQTRTLQLDEDVLYVSYSPNQKLLAVSLLDCTVKIFYVDTLKFFLSLYGHKLPVICMD
ISYDGALIATGSADRNVKIWGLDFGDCHKSLFAHDDSVMYLRFVPKSHLFFTAGKDHKIK
QWDADRFEHIQTLEGHHQEIWCLAVSPNGDYVVSSSHDKSLRLWERTREPLILEEEREME
REAEYEESVAKEDQPAVPGEIQGDNYFAGKKTIETVKAAERIMEAIELYREETAKMKEHK
AICKAAGKEVPLPTNPILMAYGNISPSAYVLEIFKGIRSSELEESLLVLPFSYVPDILTL
FNEFMQLGSDVELICRCLFFLLRIHFGQITSNQMLVPVIEKLRETTISKVSQVRDVIGFN
MAGLDYLKRECEAKSEVTFFADATSHLEEKKRKRKKREKLILTLT
Download sequence
Identical sequences F7HWL5
ENSCJAP00000010659 ENSCJAP00000010659

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]