SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000011877 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000011877
Domain Number 1 Region: 114-182,488-621,676-826
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 3.06e-34
Family Quinoprotein alcohol dehydrogenase-like 0.027
Further Details:      
 
Domain Number 2 Region: 33-233,331-401
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.65e-19
Family WD40-repeat 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000011877   Gene: ENSCJAG00000006430   Transcript: ENSCJAT00000012527
Sequence length 1224
Comment pep:novel chromosome:C_jacchus3.2.1:12:108772970:108835760:1 gene:ENSCJAG00000006430 transcript:ENSCJAT00000012527 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPYTVNFKVSARTLTGALNAHNKAAVDWGWQGLIAYGCHSLVVVIDSITAQTLQVLEKH
KADVVKVKWARENYHHNIGSPYYLRLASADVNGKIIIWDVAAGIAQCEIQEHAKPIQDVQ
WLWNQDASRDLLLAIHPPNYIVLWNADTGTKLWKKSYADNILSFSFDPFDPSHLTLLTSE
GIVFISDFSPSKPPSGPGKKVYISSPHSSPAHNKLATATGAKKALNKVKILITQEKPSAE
FMTLNDCLQLAYLPSKRNHMLLLYPREILILDLEVNQTVGVIAIERTGVPFLQVIPCFQR
DGLFCLHENGCITLRVRRSYNNIFTTSSEEPDPDPVQELTYDLRSQCDAIRVTKTVRPFS
MVCCPVNENAAALVVSDGRVMIWELKSAVCNRNSRNSSSGVSPLYSPVSFCGIPVGVLQN
KLPDLSLDNMIGQSAIAGEEHPKGSVLREVHLKFLLTGLLSGLPAPPFATRMCPPLTTKN
IKTYQPLLAVGTSNGSVLVYHLTSGLLHKELSIHSCEVKGIEWTSLTSFLSFATSTPNNM
GLVRNELQLVDLPTGRSIAFRGERGNDESPIEMIKVSHLKQYLAVVFKDKPLELWDIRTC
TLLREMSKNFPAITALEWSPSHNLKSLRKKQLATREAMARQTVVSDTELSIVESSVISLL
QEAESKSELSQNISAREHFVFTDNDGQVYHLTVEGNSVKDSARIPPDGSMGSITCIAWKG
DTLVLGDMDGNLNFWDLKGRVSRGIPTHRSWVRKIRFAPGKGNQKLIAMYNDGAEVWDTK
EVQMVSSLRSGRNVTFRILDVDWCTSDKVILASDDGCIRVLEMSMKSACFRMDEQELTEP
VWCPYLLVPRASLALKAFLLHQPWNGQYSLDISHVDYPENEEIKNLLQEQLNSLSNDIKK
LLLDPEFTLLQRCLLVSRLYGDESELHFWTVAAHYLHSLSQEKSASTAPFKEAAPRDKLS
NPLDICYDVLCENAYFQKFQLERVNLQEVKRSTYDHTRKCTDQLLLLGQTDRAVQLLLET
SADNQHYYCDSLKACLVTTVTSSGPSQSTIKLVATNMIANGKLAEGVQLLCLIDKAADAC
RYLQTYGEWNRAAWLAKVRLNPEECADVLKRWVDHLCSPQVNQKSKALLVLLSLGCFFSV
AETLHSMRYFDRAALFVEACLKYGAFEVTEDTEKLITAIYADYARSLKNLGFKQGAVLFA
SKAGAAGKDLLNELESSKEEPSQD
Download sequence
Identical sequences F7H3Z7
ENSCJAP00000011877 ENSCJAP00000012035 XP_002756713.2.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]