SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000012741 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000012741
Domain Number 1 Region: 50-243
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.000000000824
Family Quinoprotein alcohol dehydrogenase-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000012741   Gene: ENSCJAG00000006824   Transcript: ENSCJAT00000013424
Sequence length 1000
Comment pep:known chromosome:C_jacchus3.2.1:7:53230283:53265364:-1 gene:ENSCJAG00000006824 transcript:ENSCJAT00000013424 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAEWASYFWLWAALLISVAAVYEDQVGKFDWCVRVEYIREISGCFLSTRLLPAKGRGVV
ILKNKQKNVIAALNSRTGEILWRHVDKGTAEGAVDAMLLHGQDAITVSNGGRIMRSWETN
IGGLNWEITLDSGSFQALGLVGLQESVRYIAVLKKTTLALYHLSSGHLKWVEHLPESDSI
HYQMVYSYGSGVVWALGVVPFSHVNIVKFNVEDGEIVQQVRVSTPWLQHLTGACGMVDEA
VLVCPDPSSRSLQTLALETEWELRQIPLQSLDLEFGSGFQPRVLPTQPNPVDSSRAQFFL
QLSPSHYALLQYHYGTLSLLKNFPQTALVSFATTGEKTVTAVMTCRNEVQKPSNSEDGSM
GSFLEKSSSKDSLACFNQTYTINLYLVETGRRLLDTTITFSLEQSGTRPERLYIQVFLKK
DDSVGYRALVQTEDHLLLFLQQLAGKVVLWSREESLAEVVSLEMVDLPLTGAQAELEGEF
GKKADGLLGMFLKRLSSQLILLQAWTSHLWKMFYDARKPRSQIKNEINIDTLARDEFNLQ
KMMVMVTASGKLFGIESSSGTILWKQYLPNVKPDSSFKLMVQRTTAHFPHPPQCTLLVKD
KELGMSSLYVFNPIFGKWSQVAPPVLKRPILQSLLLPVMDQDYAKVLLLIDDEYKVTPFP
ATRNVLRQLHELAPSIFFYLVDAEQGRLCGYRLRKDLTTELSWELTIPPEVQRIVKVKGK
RSSEHVHSQGRVMGDRSVLYKSLNPNLLAVVTESTDTHHERTFIGIFLIDGVTGRIIHSS
VQKKAKGPVHIVHSENWVVYQYWNTKARRNEFTALELYEGTEQYNATAFSSLDRPQLPQV
LQQSYIFPSSISAMEATITERGITSRHLLIGLPSGAILSLPKALLDPRRPEIPTEQSREE
NLIPYSPDVQIHAERFINYNQTVSRMRGIYTAPSGLESTCLVVAYGLDIYQTRVYPSKQF
DVLKDDYDYVLISSVLFGLVFATMITKRLAQVKLLNRAWR
Download sequence
Identical sequences F6S2Z4
ENSCJAP00000012736 ENSCJAP00000012741

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]