SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000012783 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000012783
Domain Number 1 Region: 194-706
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 2.43e-50
Family Quinoprotein alcohol dehydrogenase-like 0.015
Further Details:      
 
Domain Number 2 Region: 659-811
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.000000863
Family Quinoprotein alcohol dehydrogenase-like 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000012783   Gene: ENSCJAG00000006842   Transcript: ENSCJAT00000013472
Sequence length 812
Comment pep:novel chromosome:C_jacchus3.2.1:10:125705198:125804057:1 gene:ENSCJAG00000006842 transcript:ENSCJAT00000013472 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DDSASAASSMEVTDRIASLEQRVQMQEDDIQLLKSALADVVRRLNITEEQQAVLNRKGPT
KARPLMQTLPLRTTVNNGTVLPKKPSGSLPSPSGARKETAVPATKRLNRSVSLLNACKLN
RSTPSNIKRTSSSERVSPGGRRESNGDSKGNRNRTGSTSSSSSGKKNSESKPKEPVFSAE
EGYVKMFLRGRPITMYMPKDQVDSYNLEAKVELPTKRLKLEWVYGYRGRDCRNNLYLLPT
GETVYFIASVVVLYNVEEQLQRHYAGHNDDVKCLAVHPDRITIATGQVAGTSKDGKQLPP
HVRIWDSVTLNTLHVIGIGFFDRAVTCIAFSKSNGGTNLCAVDDSNDHVLSVWDWQKEEK
LADVKCSNEAVFAADFHPTDTNIIVTCGKSHLYFWTLEGSSLNKKQGLFEKQEKPKFVLC
VTFSENGDTITGDSSGNILVWGKGTNRISYAVQGAHEGGIFALCMLRDGTLVSGGGKDRK
LISWSGNYQRLRKTEIPEQFGPIRTVAEGKGDVILIGTTRNFVLQGTLSGDFTPITQGHT
DELWGLAIHASKPQFLTCGHDKHATLWDAVGHRPVWDKIIEDPAQSSGFHPSGSVVAVGT
LTGRWFVFDTETKDLVTVHTDGNEQLSVMRYSPDGNFLAIGSHDNCIYIYGVSDNGRKYT
RVGKCSGHSSFITHLDWSVNSQFLVSNSGDYEILYWVPSACKQVVSVETTRDIEWATYTC
TLGFHVFGVWPEGSDGTDINAVCRAHEKKLLSTGDDFGKVHLFSYPCSQFRAPSHIYGGH
SSHVTNVNFLCEDSHLISTGGKDTSIMQWRVI
Download sequence
Identical sequences F6R580
ENSCJAP00000012783 ENSCJAP00000012789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]