SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000015683 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000015683
Domain Number 1 Region: 589-668,884-1093
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.54e-63
Family Protein kinases, catalytic subunit 0.00056
Further Details:      
 
Domain Number 2 Region: 107-269,307-356
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 8.5e-18
Family Quinoprotein alcohol dehydrogenase-like 0.005
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000015683
Domain Number - Region: 461-527
Classification Level Classification E-value
Superfamily TM1622-like 0.0876
Family TM1622-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000015683   Gene: ENSCJAG00000008471   Transcript: ENSCJAT00000016570
Sequence length 1117
Comment pep:known chromosome:C_jacchus3.2.1:14:18969263:19041988:1 gene:ENSCJAG00000008471 transcript:ENSCJAT00000016570 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERATRLGLLVRALLLPLLPLLLGLAAGTVPAGRARNLPVPTAEAAFGLGAAAAPTSPAR
VPAVAAVAAAEVTVEDAEALPAAAGEQEPRSPEPDDEAELRPRGRSLVIISTLDGRIAAL
DPENHGKKQWDLDVGSGSLVSSSLSKPEVFGNKMIIPSLDGDLFQWDGDRESMETVPFTV
ESLLESSYKFGDDVVLVGGKSLTTYGLSAYSGKVRYICSALGCRQWDSDEMEQEEDILLL
QRTQKTVRAVGPRSGNEKWNFSVGHFELRYIPDMETRAGFIESTFKPNENTEESKIISDV
EEQEAAIMDIVIKVSVADWKVVAFSKKGGHLKWEYQFCTPIASAWLVKDGKVIPISLFDD
TSYTSNDDVLEDEEDIVEAARGATENSVYLGMYRGQLYLQSSVRISEKFPTSPKALESVS
NENAIIPLPTIKWKPLIHSPSRTPVLVGSDEFDKCLSNDKFSHEEYSNGALSILQYPYDN
GYYLPYYKRERNKRSTQITVRFLDNPNYNKNIRKKDPVLLLHWWKEIVATILFCIIATTF
IVRRLFHPHPHRQRKESETQCQTENKYDSVSGEANDSSWNDIKNSGYISRYLTDFEPIQC
LGRGGFGVVFEAKNKVDDCNYAIKRIRLPNRELAREKVMREVKALAKLEHPGIVRYFNAW
LEAPPEKWQEKMDEIWLKDESTDWPLSSPSPMDAPSVKICRMDPFSTKEHIEIIAPSPQR
SRSFSVGISCGQTSSSENEFSPLEFSGMDHGDISVSVDAAYNLQDSCLTDCDVEDGTMDG
NDEGHSFELCPSEASPYVRSRERTSSSIVFEDSGCDNASSKEEPKTNRLHIGNHSNKLTA
FKPTSSRSSSEATLSISPPRPTTLSLDLSKNTTEKLQPSSPKVYLYIQMQLCRKENLKDW
MNRRCTIEDRERGMCLHIFLQIAEAVEFLHSKGLMHRDLKPSNIFFTMDDVVKVGDFGLV
TAMDQDEEEQTVLTPMPAYARHTGQVGTKLYMSPEQIHGNSYSHKVDIFSLGLILFELLY
PFSTQMERVRTLTDVRNLKFPPLFTQKYPCEYVMVQDMLSPSPMERPEATNIIENAVFED
LDFPGKTVLRQRSRSMSSSGTKHSRQSSNSHSPLPSN
Download sequence
Identical sequences F7GGK0
XP_002757568.1.60252 ENSCJAP00000015692 ENSCJAP00000015683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]