SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000017253 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000017253
Domain Number 1 Region: 273-589
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.18e-35
Family Quinoprotein alcohol dehydrogenase-like 0.019
Further Details:      
 
Domain Number 2 Region: 635-893
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.37e-33
Family WD40-repeat 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000017253   Gene: ENSCJAG00000009420   Transcript: ENSCJAT00000018248
Sequence length 980
Comment pep:novel chromosome:C_jacchus3.2.1:22:15727987:15787538:1 gene:ENSCJAG00000009420 transcript:ENSCJAT00000018248 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RHGLSEAELKDVLSLDDEVLQAVYQDWTPPSKELLRFPPLLWVRLRRDLGYCLARRPVDG
STLLAIAHRQLVQVVRERYLSGSERAERHGVLADFFSGTWSQGTKKLITLPLVGKPLNLD
RKVAPQPLWFSDTVANLRKLKELPYHLLHSGRLEELKQEVLDHEGPYLSICCSAISGSIE
DPAGTTFDLCGPSLTLSESLGWSRELQLCRPAVGLSKPCKRSLLYTELLARLHFFATSHP
ALVGQLCQQAQSWFRLCAHPVLVPLGGFLQPPGGPLRATLSGCHKGITAMAWGEEEKLLV
IGTQDGIMAVWDMEEQHVIHMLTGHTGEVRCVKVFAKGTLAISASKDYTLRLWNLLSGRE
KFTIWDGSSKNLTGPQTWSLHVNEAHKVVYSASGSKINAWNLETAELVFHILGDASDPWM
CMAVLDSQATLLMVSRVGVVSLWNSATGKLQGKQHMSSIKEETPTCAVSVQKQGKLVTGF
SNGSISLVSSEGDRLLEKLPDAVRFLVVSEDESLLAAGFGRSVRIFLADSWGFHQFMAAD
LEHEDMVETAVFGTENNLIITGSLDALVQVWSLSEQGTLLDILEGVGGPVSLLASCGALV
ASASWQSSSFKVWDLSNAHRPRAPAPFLDRTGLTAVSHNGSYVYFPKIGDKNKVTIWDLA
EGEEQDSLDTSSEVRCLEVAEQHKLLFTGLVSGVVLVFPLNSRQDVICIPPPEARKAVSC
MSLSKREDRLAIAYDSIVLVLDISPGDPCPLIDGPRYTFYTQLPETISNVAVLTDYRVIY
SMTNGDLFLYECANSKAFPLEAHRSRVTCVEVSHKEQLLASGSEDALLCLWDLQAWKRIF
EMTYTSSYCRGVQCACFSKDDNYVYVGLKDRSILVWSVLDGTLLTVQFVHAVVNRIIPTT
SGFIAPTRHGYLIRERFQCLLARASQQDPHKDFKKAVWMVKSRQREALAAAAGAFQDLES
ESAQGNESKSNKCSQVCLIV
Download sequence
Identical sequences F7HW24
ENSCJAP00000017253 ENSCJAP00000017253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]