SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000017684 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000017684
Domain Number 1 Region: 87-234,480-593,642-744
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 3.61e-48
Family Quinoprotein alcohol dehydrogenase-like 0.023
Further Details:      
 
Domain Number 2 Region: 200-237,282-517
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.38e-17
Family WD40-repeat 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000017684   Gene: ENSCJAG00000009616   Transcript: ENSCJAT00000018701
Sequence length 1523
Comment pep:novel chromosome:C_jacchus3.2.1:22:29853303:29899978:1 gene:ENSCJAG00000009616 transcript:ENSCJAT00000018701 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVGSGSYARNDAGEKLPSVMAGVPARRGQSSPPPAPPLCLRRRTRFSTAPEETVQNRV
SLEKVLGITAQNSSGLTCDPSTGHVAYLAGCVVVILDPKENKQQHIFNTARKSLSALAFS
PDGKYIVTGENGHRPAVRIWDVEEKNQVAEMLGHKYGVACVAFSPNMKHIVSMGYQHDMV
LNVWDWKKDIVVASNKVSCRVIALSFSEDSSYFVTVGNRHVRFWFLEVSTETKVTGTVPL
VGRSGILGELHNNIFCGVACGRGRMAGSTFCVSYSGLLCQFNEKRVLEKWINLKVSLSSC
LCVSQELIFCGCTDGIVRIFQAHSLHYLANLPKPHYLGVDVAQGLEPSFLFHRKAEAIYP
DTVALTFDPIHQWLSCVYKDHSVYIWDIKDINRVGKVWSELFHSSYVWNVEVYPEFEDQR
ACLPSGSFLTCSSDNTIRFWNLDSSPDSHWQKNIFSNTLLKVVYVENDIQHLQDTSHFPD
RGSENGTPMDVKAGVRVMQVSPDGQHLASGDRSGNLRQQELHFMDELVKVEAHDAEVLCL
EYSKPETGMTLLASASRDRLIHVLNVEKNYNLEQTLDDHSSSITAIKFAGNRDIQMISCG
ADKSIYFRSAQRGSDRLHFVRTHHVAEKTTLYDMDIDITQKYVAVACQDRNVRVYNTVNG
KQKKCYKGSQGDEGSLLKVHVDPSGTFLATSCSDKSISVIDFYSGECIAKMFGSEIITSM
KFTYDCHHLITVSGDSCVFIWHLGPEITNCMKQHLLEIDRREQQQHMKDRNWSGHPRQDT
YASTPSEIRSLSPGEQTEDDLEEECEPEEMLKTPFKDSLDPDPRCLLTNGKLPLWAKRLL
GDDDVPDGSAFHAKRSYQPHGRWAERADQEPLKTILDAQDLDCYFTPMKPENLENSVLDS
LEPQSLAGLLSESDSPQEAGCGHPSFLPQQRESSNEASELILYTLEAEVTVTGTDSQYCG
KEAEARPGDQQGDSYLRVSSVSPKDQSPPEGNGEFDPVLKTSFMRVASAMTHGVGGSSCP
SPPSLSGYTGPTEDELSLPEGPSVPSSSLPQTPEQEKFLRHHFETLTESPCRELFPTALG
DTEASEAEDYYFNPRLSISTQFLSSHQKASRFTHTFPSRATQHLVKPPEVKPTDRGRSQP
KAGTGYTSQDGTHVLAAGKVQETLEAWRPPPPCLTGPVPCVPASSVLPTDGKLPTPTSAP
TLGLAQGVHAPSTCSYMEAPANSHARISRSISLGDSKGPIVEELARPLCRPSSVGDLASL
GQELQTTTTTVTPNLDSESQEPALHSWGNHEARANLRLTLSSVCDELLLPPVDAQPDVTV
PGTASFSAPNPVDGSTLRLHGPAFLPSLPASESPGLPAHPSSPQLPEAGPGVPGSTASVL
EPTSGALGLIEGSPACWSEPWVPAEALPPSPFELSRVGNILHRLQTAFQEALDLYHVLAS
SDQVDTRQQQAQNELVSTFLWIHSQLEANCLVGTSVAPAQALPSPGPPSPPTLYPLASPD
LQALLEHYSELLVQAVRRKARGH
Download sequence
Identical sequences F7HL12
ENSCJAP00000017676 ENSCJAP00000017684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]