SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000018324 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000018324
Domain Number 1 Region: 72-160,229-263
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 3.53e-39
Family Inhibitor of apoptosis (IAP) repeat 0.00000248
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000018324   Gene: ENSCJAG00000009955   Transcript: ENSCJAT00000019359
Sequence length 289
Comment pep:novel chromosome:C_jacchus3.2.1:5:56846585:57227344:1 gene:ENSCJAG00000009955 transcript:ENSCJAT00000019359 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPEDSAKCLHRGPEPSPEEHRGPHTLCCPVLGLDTFRAWDHVDGQILGQLRPLAAEEEE
DGAGATSPRGPAFPGMGSEELRLASFYDWPLTAGVPPELLAAAGFFHTGQQDKVRCFFCY
GGLQSWKCGDDPWTEHAKWFPRCQFLLQSKGRDFVHSVQEAHSQLLGSWDPWEEPEDAAP
VAPSAPAPRDPELPMPRREVQSEGTQEPGGASPTQARRAWWVLEPPGARDMEEQLRQLQE
ERTCKVCLDHAVSIFVPCGHLVCATCASSLQLCPICRAPVQGRVRTFLS
Download sequence
Identical sequences F7ERH0
ENSCJAP00000018324 ENSCJAP00000018318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]