SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000018644 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000018644
Domain Number 1 Region: 40-418
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 2.2e-50
Family Quinoprotein alcohol dehydrogenase-like 0.032
Further Details:      
 
Domain Number 2 Region: 1542-1616,1668-1813,1871-1939
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.65e-42
Family WD40-repeat 0.0085
Further Details:      
 
Domain Number 3 Region: 663-1009
Classification Level Classification E-value
Superfamily WD40 repeat-like 7.78e-42
Family WD40-repeat 0.0016
Further Details:      
 
Domain Number 4 Region: 707-799,982-1134,1209-1253,1424-1508
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 4.39e-39
Family Quinoprotein alcohol dehydrogenase-like 0.042
Further Details:      
 
Domain Number 5 Region: 351-576
Classification Level Classification E-value
Superfamily TolB, C-terminal domain 3.27e-25
Family TolB, C-terminal domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000018644   Gene: ENSCJAG00000010107   Transcript: ENSCJAT00000019694
Sequence length 1941
Comment pep:known chromosome:C_jacchus3.2.1:14:52523429:52803505:-1 gene:ENSCJAG00000010107 transcript:ENSCJAT00000019694 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XVHPVCRKQTLYYTAGKEVVYFVAGVGVIYNTRENSQKFFLGHTDDIISLALHPDKTLVA
TGQVGKEPYICVWDSYNVQTVSILKDVHTHGVACLAFDSDGQRLASVGLDAKNTVCIWDW
RKGKLLASATGHSDRIFDISWDPYQPNRVVSCGVKHIKFWTLCGNALTAKRGIFGKTGDL
QTILCLACAKEDITYSGALNGDIYVWKGLNLVRTIQGAHSAGIFSMYVCEEGFATGGRDG
CIRLWDTDFKSITKIDLRETEQGYKGLSIRSVCWKADRLLAGTQDSEIFEVIVRERDKPM
LILQGHCEGELWALALHPKKPLAVTGSDDRSVRLWSLADHALIARCNMEEAVRSVAFSPD
GSQLALGMKDGSFIVLRVRDMTEVVHIKDRKEVIHEMKFSPDGSYLAVGSNDGPVDVYAV
AQRYKKIGECNRSLSFITHIDWSLDSKYLQTNDGAGERLFYKMPSGKPLTSKEEIKGIPW
ASWTCVKGPEVSGIWPKYTEVTDVNSVDANYNSSVLVSGDDFGLVKLFKFPCLKRGARFR
KYVGHSAHVTNVRWSHDFQWVLSTGGADHSVFQWRFIPEGVSNGMLETAPQEGGTDSYSE
ESDSDLSDVPELDSDIEQETQINYDRQVYKEDLPQLKQQSKEKNHVVPFLKREKAPEDSL
KLQFIHGYRGYDCRNNLFYTQAGEVVYHIAAVAVVYNRQQHSQRLYLGHDDDILSLTIHP
VKDYVATGQVGRDAAIHVWDTQTLKCLSLLKGQHQRGVCALDFSADGKCLVSVGLDDFHS
IVFWDWRKGEKIATTRGHKDKIFVVKCNPHHVDKLVTVGIKHIKFWQQAGGGFTSKRGTF
GSVGKLETMMCVSYGRMEDLVFSGAATGDIFIWKDVLLLKTVKAHDGPVFAMYALDKGFV
TGGKDGIVELWDDMFERCLKTYAIKRSALSTSSKGLLLEDNPSIRAITLGHGHILVGTKN
GEILEIDKSGPMTLLVQGHMEGEVWGLAAHPLLPICATVSDDKTLRIWELSAQHRMLAVR
KLKKGGRCCAFSPDGKALAVGLNDGSFLVVNADTVEDMVSFHHRKEMISDIKFSKETGKY
LAVASHDNFVDIYNVLTSKRIGICKGASSYITHIDWDSRGKLLQVNSGAKEQLFFEAPRG
KRHVIRPSEIEKIEWDTWTCVLGPTCEGIWPAHSDITDVNAASLTKDCSLLATGDDFGFV
KLFSYPVKGQHARFKKYVGHSAHVTNVRWLHNDSVLLTVGGADTALMIWTREFVGTQESK
LVDSEESDTDVEEDGGYDSDVAREKAIDYTTKIYAVSIREMEGTKPHQQLKEVSVEERPP
VSRAAPQPEKLQKNNITKKKKLVEELALDHVFGYRGFDCRNNLHYLNDGADIIFHTAAAG
IVQNLSTGSQSFYLEHTDDILCLTVNQHPKYRNVVATSQIGTTPSIHIWDAMTKHTLSML
RCFHSKGVNYVNFSATGKLLVSVGVDPEHTITVWRWQEGAKVASRGGHLERIFVVEFRPD
SDTQFVSVGVKHMKFWTLAGSALLYKKGVIGSLGAAKMQTMLSVAFGANNLTFTGAINGD
VYVWKDHFLIRLVAKAHTGPVFTMYTTLRDGLIVTGGKERPTKEGGAVKLWDQEMKRCRA
FQLETGQLVECVRSVCRGKGKILVGTKDGEIIEVGEKNAASNILIDGHMEGEIWGLATHP
SKDLFISASNDGTARIWDLADKKLLNKVSLGHAARCAAYSPDGEMVAIGMKNGEFVVLLV
NSLKVWGKKRDRKSAIQDIRISPDNRFLAVGSSEHTVDFYDLTQGTNLNRIGYCKDIPSF
VIQMDFSADGKYIQVSTGAYKRQVHEVPLGKQVTEAMVIEKITWASWTSVLGDEVIGIWP
RNADKADVNCACVTHAGLNIVTGDDFGLVKLFDFPCTEKFAKHKRYFGHSAHVTNIRFSY
DDKYVVSTGGDDCSVFVWRCL
Download sequence
Identical sequences F7GVL7
ENSCJAP00000018644 ENSCJAP00000018644

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]