SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000021557 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000021557
Domain Number 1 Region: 61-415
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.000000000314
Family Quinoprotein alcohol dehydrogenase-like 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000021557   Gene: ENSCJAG00000037284   Transcript: ENSCJAT00000022785
Sequence length 552
Comment pep:novel chromosome:C_jacchus3.2.1:12:267550:287405:1 gene:ENSCJAG00000037284 transcript:ENSCJAT00000022785 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLDNKDLEAEIYPLKNEERKSQENLGNPSKNEDNLKSTPPQAQLSRCRSVAFFISLFLCL
FVVFVVSFVIPCPDRPASQRMWRMDYNAAVTYDFLAVNDINGDRIQDILFLYKNTNSSNN
FNQSCVDEGFSSSCTFAAVLSGANGSTLWERPVAQDVAFVECVVPRPRGGKVPPSCILVG
RPGSLTAVNFFTGETLWHHPSSFSRNASILSPLLQVPDVDSDGVPDLLVLTQEQEEVSGH
LYSGRNGDQIGLRGSLGVDGESGFLLHVTRTGAHYILFPCASSLCSWSVKDLYEKVTGRD
GLFKKDPVWESMFNATTHRMLSHSSGAVRYVMHVPGSTGTDVFLVGSEACVLLDGQKLTQ
RWPPRAARVLRKPIFGHYKPDTLTVVVENGTGADRQILFLDLSTGDVLRSLALPSLPGGP
LSTSLPTADHRSAFFFWGLHELGSTSETETGEAQHSLYMFHPTLPHVLLELANVSTHIVA
FNAVLFEPSRHAAYILLTGPANSEAPGLVSVIKHKVRDLVPSSRVVHLGEGGPDSDQAIR
DRFSQLRYRSEA
Download sequence
Identical sequences F6TGB9
ENSCJAP00000021557 ENSCJAP00000021564 XP_009007064.1.60252 XP_009007065.1.60252 XP_009007066.1.60252 XP_009007067.1.60252 XP_017834081.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]