SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000022044 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000022044
Domain Number 1 Region: 843-885,1106-1220,1271-1327,1383-1517
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 8.24e-46
Family Quinoprotein alcohol dehydrogenase-like 0.016
Further Details:      
 
Domain Number 2 Region: 340-437,484-502,533-777
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 7.85e-44
Family Quinoprotein alcohol dehydrogenase-like 0.022
Further Details:      
 
Domain Number 3 Region: 1452-1697
Classification Level Classification E-value
Superfamily Tricorn protease domain 2 2.88e-17
Family Tricorn protease domain 2 0.051
Further Details:      
 
Domain Number 4 Region: 795-957
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 2.9e-16
Family Quinoprotein alcohol dehydrogenase-like 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000022044   Gene: ENSCJAG00000012003   Transcript: ENSCJAT00000023305
Sequence length 1707
Comment pep:novel chromosome:C_jacchus3.2.1:12:673077:683044:1 gene:ENSCJAG00000012003 transcript:ENSCJAT00000023305 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DKTLKGAVYRIRGSVSAANYIQLPKTSTQSLGLTGRYLYVLFRPLPSKHFVIHLDVSTED
GQVIRVSFSNLFKEFKSTATWLQFPFILEAGTLQRGLVGLAAAGPRWTCLQLDLQDILLV
YLNRRYHHLKGIRLCASLLVRNLYTSDLCFQPAVTGTQGTKLPLTPMPREMAFPVPKGES
WHDRYIHVRFPSDRLKVPSELTQESRSPPEAVLLGPGPVASSKAVRNSVSPVVQMLGPTA
SGQAPWAPRPFREVSLTREHPEASSGDGPRPLEPWAQAEASDVHTAAAGTHVLTHESAEM
EESAQDAGSCKRFLPDPVLRLKGVIGFGGHSTRQAVWTADGAAVVYPCHSVIIVLLVDTR
EQRFFLGHTDKVSALALDGGSSLLASAQAGAPSMMRLWDFQTGGCLSLFRSPMHAVCSLS
FADRGALLCGVGKDRHGRTMVVAWGTGQVGLGGKVVVLAKALTDCDIQAFRVACFDETRM
ASCGQGSVLLWRLRGGVLRSCPVDLGENHVLYFTDLAFKQAQDGCQETSATMLFVCSRSG
HVLEIDCQRVVVKCARRLLPARTPGGPRPQKQTFSSGPGIAISSLSVSPAVCAVGSEDGY
LRLWPLDFSSVLLEAEHEGPVSSVCVSPDGLRVLSTTSSGYLGFLDTPSRVYRVLARSHT
APVLALATEQRRGQLATVSQDRTIRIWDLATLQQLYDFTSSEEAPCAVAFHPTRPTLFCG
FSSGAVRSFSLEAAEALVEHKCHRGAVTGLIATPDGRLLFSACCQGSLAQYSCADPQCRI
LRVAADVVCPDAPARPSALAVSGDGCLLAFVGPSRHTVTVMGSASLDELLRVGVGTLDPA
SGRLDSAVAVCFGPVALGHLLVSTSSNRVVVLDAASGHIVRELPGVHPGPCPSLAVSEDA
CFLLMAAGRVKVWDYVTKASPGPQVYIGHSEPVQAVTFSPDQHQVLSAGDAIFLWDILAT
TESEQSFPGGPPACEAGPGTGQLEDAESRAGGLPQEPVPKPSPASPPRLDICARPPKGGD
GTRDTSNLGTPRTTCLASHKAFMLAKATPSPHGLFPRPRPPRTASSPGHALAARPLPQAP
PFLLTPSLGFFAYTCGRLVVVEDLHSGAQQLWPGHPAEISTLALSHSAQVLASASGGSSV
AAHCQIRIWDVSGGLCQHLISHHSTSVLALAFSPDDRLLVTLGGHGDHTLTLWSMATCDL
VSSTCLPEPAYSVAFNPWGAGEFTCVGQGAVTFWLLQQHGADTSLQVHREPVPEAVGAGE
LTSLCYGAPPLLYCGTSSGQVCVWDTSASRCFLAWEADNSGIGLLLFSSFRLVSGSNTGR
LRLWAVGAVSDLRRRKGSGASSVLMERELVLDGAVVSASFDDSVDMGIVGTTAGTLWFVS
WAEGTSTRLISGHRSKVNEVVFSPGESHCATCSEDGSVRVWSLASMELVIQFQVLNQSCL
CLAWSPPCCGRPKQQRLAAGYGDGSLRIFSVSRTAMELKMHPHTAALTAVAFSTDGQTVL
SGDKDGLVAVSHPCTGMTFRVLSDHQSAPISTIDVTRKECGDLGVEGTDLWLAASGDQRV
SVWASNWLRNRCELVDWLSFPTPAATETQGQLPPSLAAFCPWDGALLMYVGPGVYKEVII
YNLCQKQVVEKIPLPFFAMSLSLSLGTRLLAIGFAECMLRLVDCATGTTQDFAGHDNAVH
LCRFTPSARLLFTAACNEILVWEKPGL
Download sequence
Identical sequences F7A4W3
ENSCJAP00000042843 ENSCJAP00000022044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]