SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000022836 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCJAP00000022836
Domain Number - Region: 165-244,330-371,461-566
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0022
Family Quinoprotein alcohol dehydrogenase-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000022836   Gene: ENSCJAG00000012446   Transcript: ENSCJAT00000024159
Sequence length 579
Comment pep:known chromosome:C_jacchus3.2.1:11:9687225:9721442:1 gene:ENSCJAG00000012446 transcript:ENSCJAT00000024159 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFFRVFLHFISGLSTTAVDFLPVMVHRLPVFKRHMGNTHQKKAIFGQCWGLPSVAPLLTT
VEEAPRGISARVWGHFPKWLNGCLLRIGPGKFEFGKDKYNHWFDGMALLHQFRMAEGTVT
YRSKFLQSDTYKANSAQNRIVISEFGTLALPDPCKSVFERFLSRFEPPGLVSAMTDNTNV
NYVQYKGDYYLSTETNFMNKVDIETLEKTEKVDWSKFIAVNGATAHPHYDPDGTAYNMGN
SFGPYGFSYKVIRVPAEKVDTGETIHGARVICSIASAERGTPSYYHSFGMTRNYIIFIEQ
PLKMNLWKIATSKIRGKAFSDGISWEPQCNTQFHVVDKHTGQLLPGRYYSIPFVTFHQIN
AFEDQGCVVIDMCCQDNGRTLDVYQLQNLRKTGEGLDQVYNSAVRSFPRRFVLPLNVSLN
APEGDNLSPLSYTSASAVKQADGKIWCSHENLYQEDLDKEGGIELPQINYAQFNGKKYRF
FYGCGFRHLLGDSLIKVDVVNKTLKVWREDGFYPSEPIFVPVPGTSEEDGGVVLSVVITP
NQNESNFLLVLDAKNFEELGRAEVPVQMPYGFHGTFVPT
Download sequence
Identical sequences F7HTJ0
ENSCJAP00000022836 ENSCJAP00000022836

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]