SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000023471 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000023471
Domain Number 1 Region: 697-890
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 7.85e-58
Family BCR-homology GTPase activation domain (BH-domain) 0.0000398
Further Details:      
 
Domain Number 2 Region: 501-630
Classification Level Classification E-value
Superfamily PH domain-like 3.08e-18
Family Pleckstrin-homology domain (PH domain) 0.0083
Further Details:      
 
Domain Number 3 Region: 17-87
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000056
Family SH3-domain 0.0019
Further Details:      
 
Domain Number 4 Region: 247-282
Classification Level Classification E-value
Superfamily WW domain 0.0000000223
Family WW domain 0.0026
Further Details:      
 
Domain Number 5 Region: 299-333
Classification Level Classification E-value
Superfamily WW domain 0.0000326
Family WW domain 0.0044
Further Details:      
 
Domain Number 6 Region: 265-459
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0000785
Family Quinoprotein alcohol dehydrogenase-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000023471   Gene: ENSCJAG00000012810   Transcript: ENSCJAT00000024830
Sequence length 893
Comment pep:novel chromosome:C_jacchus3.2.1:5:79265217:79268691:-1 gene:ENSCJAG00000012810 transcript:ENSCJAT00000024830 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAADVEGDVYVLVEHPFEYTGKDGRRVAIRPNERYRLLRRSTEHWWHVRSEPGGRPFYLP
AQYVRELPALGNPAATPPPGPHPGPAAPKAPAPLAYDYRFLSAPGATGLDGAPAEPRGRA
SSLCGPAQRGTATQSSSLAPGLPACLYLRPAAPVRPAQSLDDLARTAVSPPAGLLGSSGS
FKACSVAGSWVCPRPLARSDSENIYEAIQDVRGPPRKESAEQADDPPEPVYANIERQPRA
TSPGASAAPLPSPVWETHTDAVTGRPYYYNPDTGVTTWESPFEAAEGASTPATSPASVGS
HVSFETEWGQYWDEESRRVFFYNPLTGETAWEDEAEDEPEEELEMQPGLSPGSPRNPRPP
TPETDYPESLTSYPEEDYSPVGSFNEPRPTSPLSTPPGWSCHVSQDKQTVYTNHFTQEQW
VRLEDPHGKPYFYNPEDSSVRWELPQVPVPAPRSIHKSSQDSDTPAQASPPEEKVPAELD
EVGNWEEISPATAAMRTKTLDKAGVLHRTKTADKGKRLRKKHWSASWTVLEGGVLTFFKD
SKTSAAGGLRQPSKFSTPEYTVELRGASLSWAPKDKSSKKNVLELRSRDGSEYLIQHDSE
AIISTWHKAIAQGIHELSAELPPEEETESSSVDFGSSERLGSLQEKEEDARPSAATPALG
PGGLESDLSKVRHKLRKFLQRRPTLQSLREKGYIKDQVFGCALAALCERERSRVPRFVQQ
CIRAVEARGLDIDGLYRISGNLATIQKLRYKVDHDERLDLDDGRWEDVHVITGALKLFFR
ELPEPLFPFSHFRQFIAAIKLQDQAQRSRCVRDLVRSLPAPNHDTLRLLFQHLCRVIEHG
EQNRMSVQSVAIVFGPTLLRPEVEENSMPMTMVFQNQVVELILQQCSDIFAPH
Download sequence
Identical sequences F7I8M4
ENSCJAP00000023471 XP_017827922.1.60252 ENSCJAP00000023536

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]