SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000024127 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000024127
Domain Number 1 Region: 234-320
Classification Level Classification E-value
Superfamily SH2 domain 5.86e-47
Family SH2 domain 0.0000118
Further Details:      
 
Domain Number 2 Region: 10-147
Classification Level Classification E-value
Superfamily N-terminal domain of cbl (N-cbl) 9.55e-43
Family N-terminal domain of cbl (N-cbl) 0.00029
Further Details:      
 
Domain Number 3 Region: 327-404
Classification Level Classification E-value
Superfamily RING/U-box 5.61e-40
Family RING finger domain, C3HC4 0.00012
Further Details:      
 
Domain Number 4 Region: 149-233
Classification Level Classification E-value
Superfamily EF-hand 3.23e-38
Family EF-hand modules in multidomain proteins 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000024127   Gene: ENSCJAG00000013125   Transcript: ENSCJAT00000025521
Sequence length 474
Comment pep:known chromosome:C_jacchus3.2.1:22:36834716:36853581:1 gene:ENSCJAG00000013125 transcript:ENSCJAT00000025521 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVALAPRGRQWEKARAFDRAVRLLQRLEEQCSDPRLSMSPPSLRDLLPRTAQLLQEVAQ
ARRAAGGGDPGDPGGSENFLVIYLANLEAKSKQVAELLPPRGPRSANDELFREGSRLRRQ
LAKLAVIFSHMHAELRALFPGGRYCGHVYQLTKAPAHVFWRERCGARCVLPWAEFESLLG
TCHPVEPGCTALALRTTIDLTCSGHVSIFEFDIFTRLFQPWPTLLKNWQHLAVNHPGYMA
FLTYDEVRERLQAYTDKPGSYIFRPSCTRLGQWAIGYVSSDGSILQTIPANKPLSQVLLK
GQKDGFYLYPDGKNHNPDLTELCQAGPQQRIHVSEEQLQLYWAMDSTFELCKICAESNKD
VKIEPCGHLLCSRCLAAWQHSDSQTCPFCRCEIKGREAVSIYQFHGQATAEDSGDGSHQE
GRELELGQVPLSAPPLPPRSELSPRKLRNAQTKVRLLKGNFPPAALGAQDPAPA
Download sequence
Identical sequences F7DRI3
ENSCJAP00000024127 ENSCJAP00000024137 XP_008986483.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]