SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000025762 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCJAP00000025762
Domain Number - Region: 50-157
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0146
Family Myosin rod fragments 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000025762   Gene: ENSCJAG00000014014   Transcript: ENSCJAT00000027222
Sequence length 210
Comment pep:novel chromosome:C_jacchus3.2.1:11:16838220:16846577:-1 gene:ENSCJAG00000014014 transcript:ENSCJAT00000027222 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPKNKEKGRKAGVQKKKENRSADVETESRHRLVVLKKELLRDHLNLWRDEARRAKASED
QLRQRLQGVEAELEGTRSEGMQVCGEMSRQCQALQKEMGSHGKQLEEEDRGLQRQLEACQ
REAAAAWEEAEQALGEPDQALAQLQAHVADMEAKYEEILHDSLDRLLAMLRAIKPQWDGA
ALRPQAQGSRSSYASSDSPPGSLRPPASSL
Download sequence
Identical sequences F6VDB4
ENSCJAP00000025762 ENSCJAP00000025762

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]