SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000026236 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000026236
Domain Number 1 Region: 14-184
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.65e-46
Family G proteins 0.0000249
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000026236   Gene: ENSCJAG00000014269   Transcript: ENSCJAT00000027724
Sequence length 201
Comment pep:novel chromosome:C_jacchus3.2.1:6:150889368:150892592:-1 gene:ENSCJAG00000014269 transcript:ENSCJAT00000027724 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNISSNISAFQSLHIVMLGLDSAGKTTVLYRLKFNEFVNTVPTIGFNTEKIKLSNGTAK
GISCHFWDVGGQEKLRPLWKSYSRCTDGIIYVVDSVDVDRLEEAKTELHKVTKFAENQGT
PLLVIANKQDLPKSLPVAEIEKQLALHELIPATTYHVQPACAIIGEGLTEGMDKLYEMIL
KRRKSLKQKKKRTGDLRSCEG
Download sequence
Identical sequences A0A096NR34 A0A2K5QC70 A0A2K6UQ29 F7HK18 G7N984 H2P903
ENSCJAP00000026236 ENSPPYP00000014870 ENSMMUP00000015110 ENSPANP00000015504 ENSMMUP00000015110 9544.ENSMMUP00000015110 9600.ENSPPYP00000014870 ENSPPYP00000014870 ENSCJAP00000026236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]