SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000027006 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000027006
Domain Number 1 Region: 422-468,625-816
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.000000000942
Family Quinoprotein alcohol dehydrogenase-like 0.033
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000027006
Domain Number - Region: 172-225
Classification Level Classification E-value
Superfamily RILP dimerisation region 0.000876
Family RILP dimerisation region 0.0081
Further Details:      
 
Domain Number - Region: 66-135
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.022
Family Myosin rod fragments 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000027006   Gene: ENSCJAG00000014636   Transcript: ENSCJAT00000028550
Sequence length 985
Comment pep:novel chromosome:C_jacchus3.2.1:12:1777587:1841879:1 gene:ENSCJAG00000014636 transcript:ENSCJAT00000028550 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCPETRLDRTGSSPTQGIVNKAFGINTDSLYHELSTAGSEVIGDVDEGADLLGEFSVRDD
FFGMGKEVGNLLLENSQLLETKNALNVVKNDLIAKVDQLSGEQEVLRGELEAAKQAKVKL
ENRIKELEEELKRVKSEAIIARREPKEEAEDVSGYLCTESDKIPMAQRRRFTRVEMARVL
MERNQYKERLMELQEAVRWTEMIRASREHPSVQEKKKSTIWQFFSRLFSSSSSPPPAKRP
YPSVNIHYKSPTTAGFSQRRSHAMCPISAGSRPLEFFPDDDCTSSARREQKREQYRQVRE
HVRNDDGRLQACGWSLPAKYKQLSPNGGQEDTRMKNVPVPVYCRPLVEKDPTMKLWCAAG
VNLSGWRPSEEDVGNGVKPAPGRDPLTCDREGDGEPKSAHASPEKKKSKELPEMDATSSR
VWILTSTLTTSKVVIIDANQPGTVVDQFTVCNAHVLCIASIPAASDSDYPPGEMFLDSDV
NPEGAGADGVLAGITLVGCATRCNVPRSNCSSRGDTPVLDKGQGEVAAIANGKVNPSQST
EEATEATEVPDPGPSEPETAALRPGPLTEHVFTDPAPALPSGPQPGSENGPESDGSGTQP
EPEPSGDPTGAGSSAAPTMWLGAQNGWLYVHSAVANWKKCLHSIKLKDSVLSLVHVKGRV
LVALADGTLAIFHRGEDGQWDLSNYHLMDLGHPHHSIRCMAVVYDRVWCGYKNKVHVIQP
KTMQIEAKSFDAHPRRESQVRQLAWIGDGVWVSIRLDSTLRLYHAHTHQHLQDVDIEPYV
SKMLGTGKLGFSFVRITALLVAGSRLWVGTGNGVVISIPLTETVVLHRGQLLGLRANKTS
PTSGEGARPGGIIHVYGDDSSDRAASSFIPYCSMAQAQLCFHGHRDAVKFFVSVPGNVLA
TLNGSVLDSPAEGPGPAAPTSEAEGQKLRNVLVLSGGEGYIDFRIGDGEDDETEEGMGDV
SQVKPVLSKAERSHIIVWQVSYTPE
Download sequence
Identical sequences F7G741
ENSCJAP00000027014 ENSCJAP00000027006

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]