SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000027214 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000027214
Domain Number 1 Region: 110-298,340-482
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 7.3e-80
Family Quinoprotein alcohol dehydrogenase-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000027214   Gene: ENSCJAG00000014757   Transcript: ENSCJAT00000028768
Sequence length 485
Comment pep:novel chromosome:C_jacchus3.2.1:5:89311062:89321478:1 gene:ENSCJAG00000014757 transcript:ENSCJAT00000028768 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAVAEEAAVRDVQRLLVQFQDEGGQLLGSPFDVPVDITPDRLQLVCNALLAQEDPLPL
AFFVQDAEIVSSLGKTLESQAVETEKVLDIIYQPQAVFRVRAVTRCTSSLEGHSEAVISV
AFSPTGKYLASGSGDTTVRFWDLGTETPHFTCKGHRHWVLSISWSPDGKKLASGCKNGQI
LLWDPSTGKQVGRTLTGHSKWITGLSWEPLHVNPECRYVASSSKDGSVRIWDTTAGRCER
ILTGHTQSVTCLRWGGDGLLYSASQDRTIKVWRAHDGVLCRTLQGHGHWVNTMALSTDYA
LRTGAFEPAEASVNPQDLQGSLQEVKERALSRYNLVRGQGPERLVSGSDDFTLFLWSPAE
DKKPLTRMTGHQALINQVLFSPDSRIVASASFDKSIKLWDGRTGKYLASLRGHVAAVYQI
AWSADSRLLVSGSSDSTLKVWDVKAQKLAIDLPGHADEVYAVDWSPDGQRVASGGKDKCL
RIWRR
Download sequence
Identical sequences F7GHQ8
ENSCJAP00000027214 ENSCJAP00000027223 XP_002748403.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]