SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000027903 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000027903
Domain Number 1 Region: 5-311
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 7.85e-58
Family Quinoprotein alcohol dehydrogenase-like 0.047
Further Details:      
 
Domain Number 2 Region: 390-474
Classification Level Classification E-value
Superfamily RING/U-box 1.55e-24
Family U-box 0.0018
Further Details:      
 
Domain Number 3 Region: 330-398
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000000002
Family SAM (sterile alpha motif) domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000027903   Gene: ENSCJAG00000015117   Transcript: ENSCJAT00000029484
Sequence length 476
Comment pep:known chromosome:C_jacchus3.2.1:6:59795854:59843087:1 gene:ENSCJAG00000015117 transcript:ENSCJAT00000029484 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVKLIHTLADHGDDVNCCAFSFSLLATCSLDKTVRLYSLSDFTELPHSPLKFHTYAVHCC
CFSPSGHILASCSTDGTTVLWNTENGQTLAVMEQPSGSPVRVCQFSPDSTCLASGAADGT
VVLWNAQSYKLYRCGSVKDGSLVACAFSPNGSFFVTGSSCGDLTVWDDKMRCLHSEKAHD
LGITCCDFSSQPVSDGEQGLQFFRLASCGQDCQVKIWVVSFTRIFGFELKYKSMLSGHCA
PVLACAFSHDGQMLVSGSVDKSVIVYDTNTENILHTLTQHTRYVTTCAFAPHTLLLATGS
MDKTVNIWQFDLETLCQARSTEDHLKQFTEDWSEEDVSTWLCAQGLKDLVGIFKMNNIDG
KELLNLTKESLAADLQIESLGLRSKVLRKIEELRTRVKSLSSEIPDEFICPITRELMKDP
VIASDGYSYEKEAMENWISTKKRTSPMTNLVLPSVVLTPNRTLKMAINRWLELHQK
Download sequence
Identical sequences F7DS30
ENSCJAP00000027903 ENSCJAP00000027934 XP_008997088.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]