SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000028116 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000028116
Domain Number 1 Region: 345-633
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.83e-63
Family WD40-repeat 0.0000895
Further Details:      
 
Domain Number 2 Region: 101-234,271-452
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.49e-49
Family Quinoprotein alcohol dehydrogenase-like 0.038
Further Details:      
 
Domain Number 3 Region: 30-138
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.00000178
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000028116   Gene: ENSCJAG00000015245   Transcript: ENSCJAT00000029712
Sequence length 808
Comment pep:known chromosome:C_jacchus3.2.1:12:2622366:2628594:-1 gene:ENSCJAG00000015245 transcript:ENSCJAT00000029712 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAETAAGVGRFKANYVVERKIEPFYKGGKVQLDQTGQHLFCVCGTRVNILEVASGAVLQS
LEQEDQEDITAFDLSPDDEVLVTASRALLLAQWAWREGSVTRLWKAIHTAPVATMTFDPT
STLLATGGCDGAVRVWDVVRHYGTHHFRGSPGVVHLVAFHPDPTRLLLFSSAADAAIRVW
SLQDRSCLAVLTAHYSAVTSLAFSADGHTMLSSGRDKICIIWDLQSHQAVRTVPVFESVE
TAVLLPEEPASELGVKSPGLHFLTAGDQGTLRVWEAASGQCVYTQARPPGPGRELTHCTL
ARTAGLLLSATADHNLLLYEARSLRLQKQFAGYSEEVLDVRFLGPEDSHIIVASNSPCLK
VFELQTSACQILHGHTDIVLALDVFRKGWLFASCAKDQSVRIWRMNKAGQVVCVAQGPGH
THSVGTVCCSRLKESFLVTGSQDCTVKLWPLPKALLSKNTAPDSGPVLLQPQTNQRCHDK
DINSVAIAPNDKLLATGSQDRTAKLWALPQCQLLGVFSGHRRGLWCVQFSPMDQVLATAS
ADGTIKLWALQDFSCLKTFEGHDASVLKVAFVSRGTQLLSSGSDGLVKLWTIKNNECVRT
LDAHDDKVWGLHCSRLDDCALTGASDSRVILWKDVTEAEQAEEQARQEEQAVRQQELDNL
LHEKRYLRALGLAVSLDRPHTVLTVIQAIRRDPEACEKLEATVLRLRRDQKEALLRFCVT
WNTNSRNCHEAQAVLGVLLRHEDPAELLAYEGVHAALEALLPYTERHFQRLSRTLQAATF
LDFLWHNMKLPVLAAAPMPWETHKGTLS
Download sequence
Identical sequences F7BRP9
XP_009007212.1.60252 ENSCJAP00000028116 ENSCJAP00000028116

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]