SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000030917 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000030917
Domain Number 1 Region: 222-306
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0000518
Family Quinoprotein alcohol dehydrogenase-like 0.025
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000030917
Domain Number - Region: 79-215,257-293
Classification Level Classification E-value
Superfamily Tricorn protease domain 2 0.00183
Family Tricorn protease domain 2 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000030917   Gene: ENSCJAG00000016790   Transcript: ENSCJAT00000032671
Sequence length 2263
Comment pep:novel chromosome:C_jacchus3.2.1:19:33919879:34003455:1 gene:ENSCJAG00000016790 transcript:ENSCJAT00000032671 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VASSAGLTPRAVGALRLSGVAVCATCAGAWPHGSMQDLRAQVTSGLLPFPEVTIQALGED
EITLESVLRGKFAAGKNGLACLACGPQLEVVNSMTGERLSAYRFSGVSEQPPVVLAVKEF
SWQKRTGFLIGLEETEGSVLCLYDLGISKVVKAVVLPGRVTAIEPIINHGGASASSQHLH
PSLRWLFGVAAVVTDVGQILLIDLCLDDLSYNQNEVDASDLEVLTGIPAEVPRIRDSVMR
EGRHLCFQLVSPTGTAISALSYISRTNQLAVGFSDGYLALWNMKSMKREYYIQLESGRVP
VYAVTFQEPENDPRNCCYLWAVQSTQDSEGDVLSLHLLQLAFGDRKCLASGHILYEGLEY
CEERYTLDLTGGMFPLRGQTSNTKLLGCQSIEKFRSHGDREEGMNEALSPDTSVSVFTWQ
VNIYGQGKPSIYLGLFDINRWYHAQMPDSLRSGEHLHNCSYFALWSLESVVSLTSPHDIL
DILVHERSLTRGVPPSYPPPEQFFNPSTYNFDATCLLNSGVLHVTCTGFQKETLTFLKKS
GASLNEVIPDGYNRCLVAGLLSPRFVDTQPSSLSQEEQLEAILSAAIQTSSLGLLTGYIK
RWITEEQPNSATNLRFVLEWTWNKVVLTKEEFDRLCVPLFDGSCHFMDPQTIQSIQQCYL
LLSNLNIVLNCFASEAREITERGLIDLSNKFVVSHLICQYAQVLLWFSHSGLLPEGIALK
HVDDAVQLSRFSYDYAAVQSYYSSRRQSLARLARGKWNPDCLMIDGLVSQLGERIEKLWQ
RDEGGTGRYPPPSLHALLDMYLLDGVTEAAKHSITIYFLLDIMYSFPNKTDASIESFPTV
FAISWGQVKLIQGFWLIDHNDYESGLDLLFHPATVKPLSWQHSKIIQAFMSQGEHRRALR
YIQTMKPAVSSGSDVTLHLTVLLFNRCMVEAWSFLRQHCNRLNIEELLKHMYEVCQEMGL
MEDLLKLPFTDTEQECLVNFLQSSASVENHEFLLVHHLQRANYVPALKLNQTLKMNVMND
RDPRLRERSLARNSILDQYGKILPRVHRKLAMERAKPYHLSASSAFRLVSRPKPLSAVPK
QVVTGTVLTRSVFINNVLSKIGEVWASKEPINSITPSISSKIEEPSPIVYSLPAPGLPEA
FFGTPISKASQKISRLLDLVVQPVPQPPQCSEFIQQSSMRSPLYLASHSLPSGSQLKGSP
QTISRASGLHLLETPLVVKKAKSLAMSVTSSGFAEFTPQSILRSALRSTPLVSPSPSPGR
SLKETRISFVEEDVDPKWIPGAADDSKAETEWLKSKDRMTSFLPNSPEKDHQEMDVGSQS
SEKRDVSKEESSVETSLEYQDAPSPEDLEHTVFMGSKPKSSSIELITKVTEHVEKDGDKD
VLGSKVTPSDLEKQTGNLEGVETKDLVAEEAFSELNHLSPIQGCGPSVHEGKIFTQKSKA
PVLDKGLTSAETCTSAVGATDDKSMADVLGDSGNSEGPVISEPRLNLKADHEIEVDGLEE
SVDFPEEKRPISDSPPDTQEIHVIEQEKLEAQDSEAARNLAFNELYPSGTLKLQYNFDTI
DQQFCDLADNKDTAECDIAEVDGELFVAQSNFTLILEGEEGEVEPGDFASSDVLPKAADT
AAEEKPVYSGENDNHGQVADLPSIMTSDQNTQKVETLPYVPEPIKVAIAENLLDVIKDTR
SKEITADTAEQSIHETIPLVSQKVMCPTKVVRSAFKTAQETSTVTINVSQVDDMVSSKTR
TRGQRIRNTSIQSAQQEASAGAATPKRPGQSVKKKTRKAEGISEASENTYSDVKDIPQNQ
QIPQQSVTPRRGRRKKVSQDILENTSSVEQELQIATGRESKRFKSSQLLEPAVEETSKKE
VKLSLITKRTPRRIKRPLENQESVEIINDLKVSKVATPRRTVRKLRSANLDASESTGNKQ
DEKRSDERLPVHCIRRVRGRGAKPSDVGEGSSLDSSQLTLQAAFDMSAMPRKRGRQRKIN
PPEDAGAKTVKEQRSPKKREAPGIKRRSTRSTPAKNENTDVGKPALGKSILVPNEELSLV
ISSKKKVTKRTENQSQKRSLHSVSEERIDEMTHTETKDREERLLATASSTKSSRSTRTRA
SKALLLPEPKSEPLFSPVSEVPRKAKAKKIEVPAQLKELVSDLSSPFVMSPPALRSRQKN
TSSKKKLEDELEDDDAQSLETVGKPKARGIRTSKTKQASKNTEKESAWSPPPVEIRLISP
LASPVDGVKSKPRKATEVTGKGLGRNRKKLSSFPKQILRRKML
Download sequence
Identical sequences F6Y2K4
ENSCJAP00000030909 ENSCJAP00000030917

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]