SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000031116 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCJAP00000031116
Domain Number - Region: 586-691
Classification Level Classification E-value
Superfamily (Trans)glycosidases 0.0186
Family Amylase, catalytic domain 0.025
Further Details:      
 
Domain Number - Region: 92-317
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0204
Family Quinoprotein alcohol dehydrogenase-like 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000031116   Gene: ENSCJAG00000016893   Transcript: ENSCJAT00000032882
Sequence length 802
Comment pep:novel chromosome:C_jacchus3.2.1:22:5466266:5522603:1 gene:ENSCJAG00000016893 transcript:ENSCJAT00000032882 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLMLLLVAAVTLWLCPLVTAQPLCRARVTGVSRPLSQSAGIRGDRLSFSSTTPRLITHPC
EKNIALYLGKQVFFTTDNFETSLLPFAIPTSMQVGAPEVTSAHFAGSLLLLVVAQKVYIY
DYENHSWNVTFGIRHPVTHVSGDNCCYTETPFCMEISNLVFAYFRGDQISQTYIYYSNTG
GFIFWKYHDDRQAEITGSLGGIFQFFSLSQVGMLVVDQGKGMFKYSDHPLNRSLGLSFDY
NGTLDILIVPGHRGILLLWFEHSLLFSHNAGQLVDTVRVKKGDQTLFSSMFEANVTIHNI
AVNENELAVITREDNLYYGNLGVLPSSVIKIADQHVWSEAAALMFRSPGMVEILTPLQDA
AFPAFDFQKCLVNIQALLMDPEFHIGRCTIEFLTGEFVHSMHNIDMNSQLELTALLIPQP
GTSLVPLVMVSNPHSLGFQAAFYESGHTLDGNTKYNLVSYVPTKPGCMQMSPMRLTSLKS
LSMEACSLSLTNLNLHLCLSPLQSTLISVGCDLDKKIVIQNKISACSKGVLEALTLQDNY
SFIIEKQFYDPSFQGQPSSQDLRVPYSYKQLGCPLLVYYDTPWKPVVELWRDTFQEIVEA
EYVLLEVNGQFSYRYSLTAKTALCTSQPQNWTTMIKEFGAPFFWNRENYVSCHDPNRNAT
LRWPDVQYQILGGRTANQIIFSHNNGIYVFYISIVDPYYSYCKLETLFSIYVYGAFPMPL
GFAGIIILLFISSILGSVWVAYLTPKLLRTRRGHRIRRFVVQLCGRCKTACGCFQCSASA
TAGVGTEPPGHHPTPQGGRAEH
Download sequence
Identical sequences F7IRX1
ENSCJAP00000031116 ENSCJAP00000031121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]