SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000032219 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000032219
Domain Number 1 Region: 724-812,895-937,993-1138,1207-1267
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.94e-47
Family WD40-repeat 0.0063
Further Details:      
 
Domain Number 2 Region: 12-353
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.84e-46
Family WD40-repeat 0.0017
Further Details:      
 
Domain Number 3 Region: 194-267,323-466,524-593
Classification Level Classification E-value
Superfamily WD40 repeat-like 6.04e-40
Family WD40-repeat 0.0053
Further Details:      
 
Domain Number 4 Region: 1574-1648,1700-1845,1903-1971
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.36e-38
Family WD40-repeat 0.015
Further Details:      
 
Domain Number 5 Region: 1405-1559,1608-1776
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 3.69e-31
Family Quinoprotein alcohol dehydrogenase-like 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000032219   Gene: ENSCJAG00000017438   Transcript: ENSCJAT00000034059
Sequence length 1977
Comment pep:known chromosome:C_jacchus3.2.1:10:114088309:114307248:-1 gene:ENSCJAG00000017438 transcript:ENSCJAT00000034059 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAARSAPSCHLRLEWVYGYRGHQCRNNLYYTAAKEIVYFVAGVGVVYSPREHRQKFYRGH
SDDIISLALHPERVLVATGQVGKEPYICIWDSYTVQTISVLKDVHTHGIACLAFDLDGQR
LVSVGLDSKNAVCVWDWKRGKMLSMAPGHTDRIFDISWDLYQPNKLVSCGVKHIKFWSLC
GNALTPKRGVFGKTGDLQTILCLACARDELTYSGALNGDIYVWKGINLIRTIQGAHAAGI
FSMNACEEGFATGGRDGCIRLWDLTFKPITVIDLRETDQGYKGLSVRSVCWRGDHILVGT
QDSEIFEIVVQERNKPFLIMQGHCEGELWALAVHPTKPLAVTGSDDRSVRIWSLVDHALI
ARCNMEEPIRCAAVNADGIHLALGMKDGSFTVLRVRDMTEVVHIKDRKEAIHELKYSPDG
TYLAVGCNDSSVDIYGVAQRYKKVGECLGSLSFITHLDWSSDSRYLQTNDGNGKRLFYRM
PGGKEVTSTEEIKGVHWASWTCVSGLEVNGIWPKYSDINDINSVDGNYVGQVLVTADDYG
IIKLFRYPCLRKGAKFRKYIGHSAHVTNVRWSHDYQWVISIGGADHSVFQWKFIPERKLK
DALHIAPQESLADSNSDESDSDLSDVPELDSEIEQETQLTYRRQVYKEDLPQLKEQCKEK
QKSATSKRRERAPGNSIRLHFVHGYRGYDCRSNLFYTQIGEIVYHVAAVGVIYNRQQNTQ
RFYMGHDDDILCLTIHPLKDYVATGQVGRDPSIHIWDTETIKPLSILKGHHQFGVSAIDF
SADGKRLVSVGIDDSHTIVLWDWKKGEKLSITRGSKDKIFVVKMNPYVPDKLITAGIKHM
KFWRKAGGGLIGRKGYIGTLGKNDTMMCAVYGWTEEMAFSGTSTGDVCIWRDIFLVKTVK
AHDGPVFSMHALEKGFVTGGKDGIVALWDDSFERCLKTYAIKRAALAPGSKGLLLEDNPS
IRAISLGHGHILVGTKNGEILEVDKSGPITLLVQGHMEGEVWGLATHPYLPICATVSDDK
TLRIWDLSPSHCMLAVRKLKKGGRCCCFSPDGKVLAVGLNDGSFLMANADTLEDLVSFHH
RKDMISDIRFSPGSGKYLAVASHDSFIDIYNVMSSKRVGICKGATSYITHIDWDIRGKLL
QVNTGAKEQLFFEAPRGKKQTIPSMEVEKIAWASWTSVLGLCCEGIWPVIGEVTDVTASC
LTNDKMVLATGDDLGFVKLFRYPTKGKFGKFKRYVAHSTHVTNVRWTYDDSMLVTLGGTD
MSLMVWSNEMEAYREKRPCDSEESDIDSEEDGGYDSDVTKENEISYTIRALSTNIRPMFG
IKPHLQQKEPSVDERQGVVRGSRPPVSRAPPQPEKLQTNNVGKKKRPIEDLVLELVFGYR
GRDCRNNVHYLNDGDDIIYHTASIGILHNVATGSQSFYQEHNDDILCLTVNQHPKFINIV
ATGQVGDSADMSATAPSIHIWDAMNKQTLSILRCYHSKGVCSVSFSATGKLLLSVGLDPE
HTITIWRWQEGAKIASRAGHNQRIFVAEFRPDSDTQFVSVGVKHVKFWTLAGRALLSKKG
LLSTLEDARMQTMLAIAFGANNLTFTGTISGDVCVWKDHILCRIVARAHNGPVFAMYTTL
RDGLIVTGGKERPSKEGGAVKLWDQELRRCRAFRLETGQATDCVRSVCRGKGKILVGTRN
AEIIEVGEKNAACNILVNGHVDGPIWGLATHPSRDFFLSAAEDGTVRLWDIADKKMLNKV
NLGHAARTVCYSPEGDMVAIGMKNGEFIILLVSSLKIWGKKRDRRCPIHDIRFSPDSQYL
AVGSSENSVDFYDLTLGPTLNRISYCKDIPSFVIQMDFSADSRYLQVSSGCYKRHVYEVP
SGKHLMDHAAIDRITWATWTSILGDEVLGIWSRHAEKADVNCACVSHSGISLVTGDDFGM
VKLFDFPCPEKFAKHKRFLGHSPHVTNIRFTSGDRHVVSAGGDDCSLFVWKCVHMPH
Download sequence
Identical sequences F7ESY6
ENSCJAP00000032219 XP_002807301.2.60252 ENSCJAP00000032219

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]