SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000032382 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCJAP00000032382
Domain Number - Region: 135-202
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0141
Family Quinoprotein alcohol dehydrogenase-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000032382   Gene: ENSCJAG00000017542   Transcript: ENSCJAT00000034225
Sequence length 533
Comment pep:known chromosome:C_jacchus3.2.1:7:104016811:104037213:-1 gene:ENSCJAG00000017542 transcript:ENSCJAT00000034225 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSIQVEHPAGGYKKLFETVEELSSPLTAHVTGRIPLWLTGSLLRCGPGLFEVGSEPFYHL
FDGQALLHKFDFKEGHVTYHRRFIRTDAYVRAMTEKRIVITEFGTCAFPDPCKNIFSRFF
SYFRGVEVTDNALVNVYPVGEDYYACTETNFITKINPETLETIKQVDLCNYVSVNGATAH
PHIENDGTVYNIGNCFGKNFSIAYNIVKIPPLQADKEDPISKSEIVVQFPCSDRFKPSYV
HSFGLTPNYIVFVETPVKINLFKFLSSWSLWGANYMDCFESNETMGVWLHIADKKRKKYF
NNKYRTSPFNLFHHINTYEDNGFLIVDLCCWKGFEFVYNYLYLANLRENWEEVKKNARKA
PQPEVRRYVLPLNIDKADTGKNLVTLPNTTATAILCSDETIWLEPEVLFSGPRQAFEFPQ
INYRKYCGKPYTYAYGLGLNHFVPDRLCKLNVKTKEIWVWQEPDSYPSEPIFVSHPDALE
EDDGVVLSVVVSPGAGQKPAYLLILNAKDLSEVARAEVEINIPVTFHGLFKKS
Download sequence
Identical sequences F7FJG4
ENSCJAP00000032382 ENSCJAP00000032382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]