SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000036078 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000036078
Domain Number 1 Region: 515-784
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.15e-31
Family Protein kinases, catalytic subunit 0.0013
Further Details:      
 
Domain Number 2 Region: 19-167
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.00000000353
Family Quinoprotein alcohol dehydrogenase-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000036078   Gene: ENSCJAG00000019415   Transcript: ENSCJAT00000038100
Sequence length 918
Comment pep:novel chromosome:C_jacchus3.2.1:5:82789609:82827500:-1 gene:ENSCJAG00000019415 transcript:ENSCJAT00000038100 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DPVLQVPTHVEEPAFLPDPNDGSLYTLGGKNNEGLTKLPFTIPELVQASPCRSSDGILYM
GKKQDIWYVIDLLTGEKQQTLSSAFADSLCPSTSLLYLGRTEYTITMYDTKTRELRWNAT
YFDYAASLPEDDVDYKMSHFVSNGDGLVVTVDSESGDVLWIQNYASPVVAFYVWQREGLR
KVMHINVAVETLRYLTFMSGEVGRITKWKYPFPKETEAKSKLMPTLYVGKYSTSLYASPS
MVHEGVAVVPRGSTLPLLEGPQTDGVTIGDKGECVITPSTDLKFDPGLKGKNKLNYLRNY
WLLIGHHETPLSASTKMLERFPNNLPKHRENVIPADSEKKSFEEVINLVDQTSENAPTTV
SRDVEEKPANAPARPEAPVDSMLKDMATIILSTFLLIGWVAFIITYPLLEMSKLRIGAGH
RGMRYSREVVLQQVAQSIETWLPGSSGREGEMTPCCQGPNSEGIGTELVQEPQSPPSQAV
CCHESGCSASSIPSFNLSFVPDEETSMVMVGKISFCPKDVLGHGAEGTIVYRGMFDNRDV
AVKRILPECFSFADREVQLLRESDEHPNVIRYFCTEKDRQFQYIAIELCAATLQEYVEQK
DFAHLGLEPITLLQQTTSGLAHLHSLNIDQSLFNPFLILVNWEGRTYIGILFLFSQPILI
TFRHRENRKSAAQSVEGMGDPESSGSQCYSSPTYTVDIFSAGCVFYYVISEGSHPFGKSL
QRQANILLGACSLDCLHPEKHEDVIARELIEKMIAMDPQKRPSAKHVLKHPFFWSLEKQL
QFFQDVSDRIEKESLDGPIVKQLERGGRAVVKMDWRENITVPLQTDLRKFRTYKGGSVRD
LLRAMRNKKHHYRELPPEVRETLGSLPDDFVCYFTSRFPHLLAHTYRVMELCSHERLFQP
YYFHEPLEPQPPVTPDAL
Download sequence
Identical sequences F7FQL2
ENSCJAP00000036078 ENSCJAP00000036078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]