SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000036193 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000036193
Domain Number 1 Region: 6-132
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 1.13e-37
Family Inhibitor of apoptosis (IAP) repeat 0.000000121
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000036193   Gene: ENSCJAG00000019490   Transcript: ENSCJAT00000038224
Sequence length 142
Comment pep:novel chromosome:C_jacchus3.2.1:5:127470479:127471486:1 gene:ENSCJAG00000019490 transcript:ENSCJAT00000038224 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAPMLPPAWQPFLKDHRISTFKNWPFLEGCACTPERMAEAGFIHCPTENEPDLAQCFFC
FKELEGWEPDDDPIEEHKKHSSGCAFLSVKKQFEELTLGEFLKLDRERAKNKIAKETNNK
KKEFEETAKKVRRAIEQLAAME
Download sequence
Identical sequences F7GEY1
ENSCJAP00000036200 ENSCJAP00000036193 XP_002748841.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]