SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000038361 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000038361
Domain Number 1 Region: 521-807
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.51e-56
Family Protein kinases, catalytic subunit 0.00043
Further Details:      
 
Domain Number 2 Region: 39-254
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.00000000000101
Family Quinoprotein alcohol dehydrogenase-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000038361   Gene: ENSCJAG00000020632   Transcript: ENSCJAT00000040528
Sequence length 927
Comment pep:known chromosome:C_jacchus3.2.1:12:22570993:22595408:-1 gene:ENSCJAG00000020632 transcript:ENSCJAT00000040528 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASAVGRSRSWPRLGLLLQFAALLGTLNPQVHTLRPESLLLVSTLDGSLHALSKQTGDLK
WTLRDDPVIQGPMYVTEMAFLSDPADGSLYILGTQKQQGLMKLPFTIPELVHASPCRSSD
GVFYTGRKQDAWFVVDPESGETQMTLTTEGPPTPRLYIGRTRSPEYTVTMHDPRAPALRW
NTTYRRYSAPPMDGSPGKYMSHLASCEMGLLLTVDPGSGTVLWTQDLGVPVMGIYTWYQD
GLRQLPHLTLARDTLHFLALRWGHIRLPASGPQDTATLFSALDTQLLMTLYVGKDEAGFY
VSKALVHTGVALVPRGLTLAPTDGPTTDEVTLQVSGEREGSPSTDVRYPSGSVALPSQWL
LIGHHELPPVLHTTMLRVHPTPGSGTTETRPPENTQAPAFLELLSLSREKLWDSNLHPEE
KTPDSYMGLGPQDLLAASLTAVLLGGWILFVMRQQQPQVVEKQQETRLTPADSAHISQDA
QSLHSGATPKSQKRLRSPLKQAQPLDNPEAEQLTVVGKISFNPKDVLGRGAGGTFVFRGQ
FEGRAVAVKRLLRECFALVRREVQLLQESDRHPNVLRYFCTEQGPQFHYIALELCRASLQ
EYVENPDLDRGGLEPEVVLQQLMSGVAHLHSLHIVHRDLKPGNILITGPDSQGLGRVVLS
DFGLCKKLSAGRCSFSLHSGIPGTEGWMAPELLQRLPRDSPTSAVDIFSAGCVFYYVLSG
GSHPFGESLYRQANILTGVPCLAHLEEEVHDKVVARDLVGAMLSPPPQARPSAAQVLAHP
FFWSKAKQLQFFQDVSDWLEKESEQEPLVRALETGGCAVVRDNWHEHIPVPLQTDLRRFR
SYKGTSVRDLLRAVRNKKHHYRELPVEVRQALGQIPDGFVQYFTNRFPRLLLHTHQAMRS
CTSESLFLPYYLPASEARGPCPGAAGR
Download sequence
Identical sequences F7I6Y8
ENSCJAP00000038362 ENSCJAP00000038361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]