SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000039014 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000039014
Domain Number 1 Region: 1158-1430
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.26e-24
Family Quinoprotein alcohol dehydrogenase-like 0.023
Further Details:      
 
Domain Number 2 Region: 976-1203
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.58e-19
Family WD40-repeat 0.019
Further Details:      
 
Domain Number 3 Region: 1325-1646
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.18e-18
Family Quinoprotein alcohol dehydrogenase-like 0.039
Further Details:      
 
Domain Number 4 Region: 394-646
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000102
Family Extended AAA-ATPase domain 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000039014   Gene: ENSCJAG00000020972   Transcript: ENSCJAT00000041210
Sequence length 1742
Comment pep:known chromosome:C_jacchus3.2.1:3:153378326:153578022:-1 gene:ENSCJAG00000020972 transcript:ENSCJAT00000041210 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWPAGAGTKLPCPRDSALRRAAFSGNLTALPSHLVPAGRSVRVFISANPEDTGAERQALR
ENVYPKLREFCRENYGLEFQVIDLYWGVEEDDWDSPELQKTRMKLLEDCLKTSAGPCFVG
LLGEKYGNIRIPGEVEASEFEMILDAAVEAKLETKLLEDWYCRDENSVPAAYYLRPKSEM
LRSNRNAMQPSANAENEKTWQEISDEIKKIFKTAVKLLHEKGKMKHSQAKRYLFSAIEDE
FDFALGKQTPAFLKKCVCYIRKIANIERFVKIPEMGKYMDITGTEPRIIRDPEAQEKLIK
LRDEFIPTIVASSNLRVYTSVTHCDMKLGYSQEIENHYIEGLGKQFYEDMIDIIQATVQQ
NFDTETDTLYDEILQHSSLCKTYASFYEYKCESLNIVHNYILPSKTGHINPLIIYGGPCT
GKTLLLAEVAKKAYGWLHEDTGPESDPVVIVRFLGTTDLSSDLRTLLLSVCEQLAVNYRC
LVQSYPKKIHDLCDLFINLLNESSLQRPLVIIFDALEQLSENDDARKLWWLPAHLPRFVR
IVLSTLPNKHGILQKLRCLIHEEDNYIELIPRDRKMCSQVLKHQLLRVKRKVTSGQQIYV
NNAFSKCTLPMFVNLTFREVRHWRSHKDVDESSLSVTVHESIEQLFWSLEKKCGQKLVSR
ALGYITMAKMGLSEMELEDVLALDNSVMSELNENTRPSNPLRVPYLYIARLKEGLSGYLI
ERHVKNVTLLVWANRHLQLIAQKLYLQDDNDLREMHTILADYFLGVWSGGRRKTFCLEDP
YLNGCLDLESRSLLEEEKHFMEQASFDRQAPDQPWVFQCNPLEPDIFFVNHRKMSELLHH
LTRCGKTDDLLYGIIMNFSWLYTMIKIGQFDKVLSDIELAYNYSQEKELKFLASTLRSIK
NKVIAFPGSLSAELQQRLLPVVSSLPKLRHLLLECDKDGPKYCSIVPLHSSMDVTYSPER
LPLSSSHLHVTEILPTRNPSTVLTALENGSISTWDVETRQLLRQITTAQSVILGMKLTSD
EKYLVVATTNNTLLIYDNVNSCLLSEVEIKGTKHGSSTTYINGFTLSANHALAWLEASKD
VTVIDLLYGWPLYQFHCWYEVTCVQCSLDGLYAFCGQYLNTTTIFHLGSGEKLCTVTSEF
SGGFVKFLLILDTAQEMVMVDSEGSLSVWNTEDISSPQLTDDFDCRREDSEVVSIELSED
QSAVLICKALSIELLDTGLWKVAEKFRAKHNDRFISAVLSKNGDCIIATMENTSAVFFWR
RDTGQCMASLQEISGSIVKLVKSSHHNMLLSLSTSGVLSIWDIDIITAMSNIDKTGKPIQ
SLLLPARGEIIYSLDGSDCVHKWNFSSGFIEAVFKHEGIVEHCVLTSTGDIMVTSDDKSS
QYVWHTNSGENLFRINGQRISQLLITHNDQFVVSLCEENASRVWRLATGHRVCNILTTLQ
NAFITSANTFVVGMTKSKVLAVSLWTGSITKKFCCEDGTTIVNFKLIPDCPDIIVFITSA
ETVNIWSLTDEVICRRVQLPNNFLKNLEDFEISPNGKLGIISRGDENINVLDLHSGKLRV
VHASGIIWRQRLSRDGRYLVYICFRNGEEEDENGAIFSLIVMRLADGKNIGACSLYKTPT
FLALSQRHLNIIVGFDDGSIGIYTVVDRVDAALKIKIATSNSRQIFNNATHTSRPKCNSY
CFKISVDCLWRESTEVFARDSPITVSDSTESNEATPTKKHNSCYERVCSALEARGHSYAP
DN
Download sequence
Identical sequences F7FG23
ENSCJAP00000039014 ENSCJAP00000039014 XP_002745970.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]