SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000039232 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000039232
Domain Number 1 Region: 33-152,242-313,342-404,438-532,621-706
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 6.04e-40
Family Quinoprotein alcohol dehydrogenase-like 0.043
Further Details:      
 
Domain Number 2 Region: 621-887
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.33e-31
Family WD40-repeat 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000039232   Gene: ENSCJAG00000021063   Transcript: ENSCJAT00000041447
Sequence length 890
Comment pep:novel chromosome:C_jacchus3.2.1:13:73794865:73840859:1 gene:ENSCJAG00000021063 transcript:ENSCJAT00000041447 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVAPVLETSHVFCCPNRVRGVLNWSSGPRGLLAFGTSCSVVLYDPLKRVVVTNLNGHTSR
VNCIQWICKQDGSPSTELVSGGSDNQVIHWEIEDNQLLKAVYLQGHEGPVYVVHAVYQRR
TSDPALYTLIVSAAADCTVRLWSKKGSEVTCLQTLNFGNGFALALCLSFLPNTDVTWKIG
QMERGRTWKPSASLALCSRNCDSMVSCYASILCKALWKEKLHTFWHHRISFILSAFRPIP
ILACGNDDCRIDLFAQQNDQFQKVLSLSGHEDWIRGVEWAAFGKDLFLASCSQDCLIRIW
KLYIKSTSLETQDDDNIRLKENTFTVENESVKITFAVSLETVLAGHENWVNAVHWQPVFY
KDGVLQQPMRLLSASMDKTMILWAPDEESGVWLEQVRVGEVGGNTLGFYDCQFNEDGTMI
IAHAFHGALHLWKQNTVNSREWTPEIVISGHFDGVQDLVWDPEGEFIITVGTDQTTRLFA
PWKRKDQSQVTWHEIARPQIHGYELKCLTMVNRFQFVSGADEKVLRVFSAPRNFVENFCA
ITGQSLNHVLCNQDSDLPEGATVPALGLSNKAVFQGDIASQPSDEEELLTSTGFEYQQVA
FQPSILTAPPTEDHLLQNTLWPEVQKLYGHGYEIFCVTCNNSKTLLASACKAAKKEHAAI
ILWNTTSWKQVQNLVFHSLTVTQMAFSPNDKFLLAVSRDRTWSLWKKQDTISPEFEPVFT
LFAFTNKVTSVHSRIIWSCDWSPDSKYFFTGSRDKKVVVWGECDSTDDCIEHNIGPCSSV
LDVGGAVTAVSICPELHPSQRYVVAVGLECGKICLYTWKKTNQVPEINDWIRCVETSQSE
SHTLAIRKLCWKNCSGKAEPKEAEGAKWLYFASCGEDHTVKIYRVNKYGL
Download sequence
Identical sequences F7FTR0
ENSCJAP00000039232 ENSCJAP00000039235

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]