SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000040259 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000040259
Domain Number 1 Region: 124-287,425-500
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.00000000151
Family Quinoprotein alcohol dehydrogenase-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000040259   Gene: ENSCJAG00000021626   Transcript: ENSCJAT00000042523
Sequence length 620
Comment pep:novel chromosome:C_jacchus3.2.1:9:8437201:8468899:-1 gene:ENSCJAG00000021626 transcript:ENSCJAT00000042523 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATVLSRALKLPGKKSPDLGEYDPLTQADSDESEDDLVLNLQKNGGVKNGKSPLGDVPEP
DSDAEVAEAAKPHLSEVTTEGYPSEPLGGLEQKAASSLVSYVRTSVFLLTLGISMILVLL
CAFLIPCPPRDLHSTWSRHLGSQGGGDLSPLELADVNGDGLRDVLLSFVMSRNGSAVGVS
RPAANLVCLSGMNGSTLWSTLLPEEARDITCLKLIPGNLAEAICLVTGTHKMLSAFNASS
GKAIWTLNPNYLSNGTLAAPVVVLPDLDEDGVRDLVLLTIGELQPDLCFLLVSGRTGRPL
GRPVKYNIVGVGNLIGPQVYITTNGAVYILFGFGNIQAVALRDIFVQAQNRDSSPPSLQI
EEPEWEKRRSINLSELIDVYSDGVELLQMVKAPDSNCSNLLITTRQGLVLLRGQNLTPYW
TSSLQGLRSQPTPGYFTDDQTLDFLLQIQDGVGMKKMMVVDGDSGSVIWSYSAPCHMKET
PATSAVTSDQKSVFLFWAEGLSPASPNSGIILGTEPPGLHHLYLLHPAFPSILLDLANTT
GTVTASEVGINDLWKDAFYVTRTTGSEGHPAALVVSKLSLRWALMEGQMAQLQESTPKIG
RGELRRFLSRIKFVEAPYEI
Download sequence
Identical sequences F7ILE3
ENSCJAP00000040260 ENSCJAP00000040261 ENSCJAP00000040259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]