SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000043069 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000043069
Domain Number 1 Region: 238-493,595-636
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 4.87e-26
Family Quinoprotein alcohol dehydrogenase-like 0.033
Further Details:      
 
Domain Number 2 Region: 476-667
Classification Level Classification E-value
Superfamily TolB, C-terminal domain 0.00000942
Family TolB, C-terminal domain 0.049
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000043069
Domain Number - Region: 914-1021
Classification Level Classification E-value
Superfamily ARM repeat 0.000111
Family GUN4-associated domain 0.097
Further Details:      
 
Domain Number - Region: 1715-1768
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.0157
Family SNARE fusion complex 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000043069   Gene: ENSCJAG00000013480   Transcript: ENSCJAT00000056712
Sequence length 2881
Comment pep:novel chromosome:C_jacchus3.2.1:22:31126395:31168111:-1 gene:ENSCJAG00000013480 transcript:ENSCJAT00000056712 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSPRLIPLWKDLKLLLNDVINKSKQPLEDPKNYLVVLSDQSQILFKESRYPQNMPCVCC
YFSDAYFFASLSWVTTNTKEIQAVVWMKSKTEDIVEKRTFSMTERLPPIQSMVHTGSFHI
LVVYCGDLILRLFGDHFRAFKPLGKVPCRFNISCLCYDPEMKMLLSGILGAVVTWVIEQG
GTGLQIAHIVSMPGDELVQDIVLNGPNGSLLALCETVVRVLMRQGKGQLGEVKRFTSTSS
GSSITCCFTCFDQGFFYVGNQAGEIQVWSLHQGHPLHSFQAHNSSVICIHSRPEAHTLLT
AGSDSLIKEWNLTSGSLLRRLELGEELYQLQFIDSITFFCQTAHSFSLRRLPCFYSLFNV
CGSAPQQLRRVCCGDNWFRILCTTEDGLLRFVSPITGDLLVITWPFSILDQAVDWAYDPG
KEELFVATGSSEVLVFDTTRCPCPAKYLLCTSPNSQDFVQCLAYGHFKLGQGLEGLIFSG
HQSGVIRVLSQHSCARLEKFMHFGAVLALSTLSGGIMGGQRNSLLCSYGMDDYVHLSEVV
LGGVKVHLRPLASILSSCHLTHLILLPKSVGAITETNCLRLWKFHDFMSFGSQDGLKFIE
TLPLHQCAITSFDVCLSLSLFVTGSIDGSVRIWDFQGRLIAILDSSLHFGPLCFANDRGD
LLVTFNQSLYLVSCLKLLPPALLTHLSYMSLPDEVLEAPKPFIPSFFFSFETMFVPKYIY
LGQGQQKLVGLEKLVNNRAIAFDHSVPHVIEEDEKGSPVLLCSSMHYSLQNMEDWMQMSK
RYRHHYVLPPQLQLTSWDGLNPYQILRYYFGHGREWLLAPDCYIPNSVIRARLWPEGTPI
YLQCNLHAPQRELEWDRFQEFFFWHSRVRAISNIEYSKKEEDEHFLEMRLSKDVTYSVLI
DRANRSWLGRKMSEIAINSMIETMLNIMIHASSLKYQSCVAALGQIFASYQVSPTLRSET
ARRLLDDTTNSNPLIRELAWEGLKRLGMITHLFAVPLAQGLMDKDERVRNKTLMLMAEIG
IHSRTSLLQLIQKPETFQEMQQEMIGEEHLDHLLGMRATDLQILYTQVEQRLNENLTLSS
SDEKPAFSLDVSKLSELKSFPMKAPTSSEEPEVAVKPSKGKRRGQAGSKKHSRKWLRGLK
KMKERGSKHMGRELGLLEDESGTEAAPIEMEDVSIHSKWSLTTSVSTLLKDVDSQEKDIS
QDRIALTLKRLRKIRDKRDKKATAQKPKKKHKKKGEAQVITGEPPVVEQPVIKKFKLQGR
GASGVSGRRPTTGGGSTWRDDLCHLMTLRISGSQTEMSENLTTELVKFAQETLVDRHPSW
ELFQEICPLLKKESKVLLEDLDWDAVPPEEKPSFTYEGAIREDMTRDVMQEVIRHKEVLP
RDEEQAQKTAKDMPGLEETQVILKKSKKKKVIFLEPGDVTKERQIPRKEEKKTFQKSPER
ERKAVQWERKAGKIKTEMTKEERDMSEEVKETATLEEEVVEQEERPVLTKRTPSWQDWKR
SWDEWKQVHGKTRKSWKAWKKDWEKRLLQEEEKLHQAGEKLSPEEEMLQEDQRKLKWKEW
KQVWENMLSSKSKEQPYEDEEVVTLEEEVSQEGEEKEEQVTEEQRQIQEEHKQARIHRKQ
AQAEKKRAQEERKLAQEEEKLAQQERQLAQEERKLAQEYIKKTQEDGKVAQAEGKFAQKE
ETLAHRGEELSQEAENLARQRRKLAKQREKVAKEEEKLAKKRGKLAEVKSILVQKVEEVA
QRQQNLDRQKELAQKLEELAWDMEELSRKEEKVNQEEETLTEEKKILAEEEETLAWEREK
LSEQERKLAQDKEKMPEGEERLAWQREQLMEKKVKLAQKRERWTNRMEELTKNKAIVYQK
KRNLAQEKNKWAQGEEHLLYGQERLTHNRKQLAQVNDKLKIFKKTLAQMEEKLTQEKETV
SKKKEKLSKREKKLVQVEDSLAEKQEKLAHEKMKSALEKAMVQGKKRLRGELDIAKEEKA
LNLEMKRLAEEKMRLLEGKEALSKGETPNTSRLRKMTKVEQELVERKLSLEEKILLHEDR
LLAIEKREIAKGKLEFTRVQRIYAQEQRKLAKDARMLIKKKESLSKEPAKLNKILKALQK
LIRDERTLTEEEIKVTKIRRSFFAKESRLNKEQSKLGIKGWGFSEKPXXXXKKKLTRKQR
KLAKEMRKNKKEEKISEEESRLARAHSEILDDEVEGGTEEEEVIPFLKQRWRKKKEANEV
DEPKEKFPSQVDEVESEEHFYEEMESLLDELEKQESLSSEEEEREEEDERDEEEEEEKEE
EEGEVEEEEEEEKRKKKKEKKEEEFQEKEEVFEEKEEIMSEEELESLSDKEEEEESSSLE
EEVDEEKEILKREKLFKLQDQRRKSLRGREKVPSIGKGVSHVKGRAMRLRVLKSPLKKLV
SIALEMREKTPVPVPEKQISWEDKKATVVAIPRKFSGTMDKEREVLGKYEPIPPPVSGTV
LESQEQDLKIPFMAHILRKTIDAQELQCKPLGPQWKWLLQHLSLLGQTEVQLPLSQIRAK
EQHADISLSDVEWICHVLERMEAGEELSKDSFHRLCQLLKDLTSKGNLEWLHLAKLEAIV
YRHRQALESQGTRISKPSRESMSPKYLKVIPPIQAKEKESWLEPLAIPTRKSPLATKRIP
DPRAKNWHLLGEPYRSERAQQISMVHKEMAMQHFHPATGDIFPSIYASVEKQTLALMFQK
DLRDFKDKRRFPKLPKLEKKTQPISKKKEKLPLWETFVALYHVLRMLQQRYGKDSTAWME
QFNQLMQLYQLKSPRIQRLLLELLQGEELQPQEIIYKEALKATELVPGERLLYCLFCGGS
HTARGPQEFQGVVPVPGQNNVHTILPVGIAQYGILELAWKSLPQADIHLTKALIHTVAPT
P
Download sequence
Identical sequences F6QJV2
ENSCJAP00000043069 ENSCJAP00000024798

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]