SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000043314 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000043314
Domain Number 1 Region: 279-563
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.37e-75
Family WD40-repeat 0.0000844
Further Details:      
 
Domain Number 2 Region: 197-308
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.00000000000000298
Family Quinoprotein alcohol dehydrogenase-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000043314   Gene: ENSCJAG00000000909   Transcript: ENSCJAT00000061190
Sequence length 568
Comment pep:novel chromosome:C_jacchus3.2.1:X:7377893:7634149:1 gene:ENSCJAG00000000909 transcript:ENSCJAT00000061190 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTELTGTSSRCCPRPARRGAMQSPVDHVQRLRGREGGSHSASTSSQRGEAKMSITSDEVN
FLVYRYLQESGFSHSAFTFGIESHISQSNINGTLVPPAALISILQKGLQYVEAEISINED
GTVFDGRPIESLSLIDAVMPDVVQTRQQAFREKLAQQQASAAASAATSTTAGVSQQNPPK
NAQTPVNGEETRAHSVNNHVKPMEVDGEVEIPSNKATVLRGHESEVFICAWNPVSDLLAS
GSGDSTARIWNLNENSNGCSTQLVLRHCIREGGHDVPSNKDVTSLDWNTDGTLLATGSYD
GFARIWTEDGNLASTLGQHKGPIFALKWNRKGNYILSAGVDKTTIIWDAHTGEAKQQFPF
HSAPALDVDWQNNTTFASCSTDMCIHVCRLGCERPVKTFQGHTNEVNAIKWDPSGILLAS
CSDDMTLKIWSMKQEVCVHDLQAHSKEIYTIKWSPSGPATSNPNSKIMLASASFDSTVRL
WDVERGVCIHTLTKHQEPVYSVAFSPDGKYLASGSFDKCVHIWNTQNGNLVYSYRGTGGI
FEVCWNARGDKVGASASDGSVCVLDLRK
Download sequence
Identical sequences F6ZFK1
ENSCJAP00000001561 ENSCJAP00000043314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]