SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000046806 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000046806
Domain Number 1 Region: 16-67
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.000000392
Family Quinoprotein alcohol dehydrogenase-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000046806   Gene: ENSCJAG00000012245   Transcript: ENSCJAT00000023732
Sequence length 73
Comment pep:novel chromosome:C_jacchus3.2.1:11:11142650:11143324:1 gene:ENSCJAG00000012245 transcript:ENSCJAT00000023732 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TDVTTTSTRIGKFEARFFHLAFEEEFGRVEGNFGPINSFAFHPDGKSYSSGGEDGYICIH
YFDPEYLEFEFEA
Download sequence
Identical sequences F7HMS9
ENSCJAP00000046806 ENSCJAP00000046806

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]