SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000052081 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000052081
Domain Number 1 Region: 184-366
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 5.49e-22
Family Quinoprotein alcohol dehydrogenase-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000052081   Gene: ENSCJAG00000033580   Transcript: ENSCJAT00000055758
Sequence length 366
Comment pep:novel chromosome:C_jacchus3.2.1:13:83747192:83748592:1 gene:ENSCJAG00000033580 transcript:ENSCJAT00000055758 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KAAPTSQPSAAEETRLRQRNCLTLEDEAAVEQSLEELVFSEVEDQEDALLRRVRGPPVQE
HKDSGDSEVENETKGNFPPQKKLVWADEEDEGEEMVDNRFWKDRMKNASENELLKDNLKM
RLKEVFQHAMGGVPAWAETHRRKMSSADESEQDNEDLSQRTGNCISASASLPRGILKNCQ
VHPTATRISPAQFHPCAQIVVVAGLLFQVDGKTNPKIQSIYLEQSPIFKACFSANGEEVL
ATSTHSKALYIYDMLAGKLILVHQVRGLKEDNSPDGSFFLLNGIAGHLHLLSVKTKELIG
STKINGRVAASTFSSDSKKVYASSGDGEVYVWDVNSRKCLNRFADEASLYGLSIATSRKG
QNVACS
Download sequence
Identical sequences F7IGW2
ENSCJAP00000052081 ENSCJAP00000052081

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]