SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000000804 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000000804
Domain Number 1 Region: 116-168
Classification Level Classification E-value
Superfamily Orange domain-like 0.00000000000000981
Family Hairy Orange domain 0.0000529
Further Details:      
 
Domain Number 2 Region: 50-127
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000628
Family HLH, helix-loop-helix DNA-binding domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000000804   Gene: ENSCJAG00000000477   Transcript: ENSCJAT00000000859
Sequence length 308
Comment pep:novel chromosome:C_jacchus3.2.1:16:31849539:31851286:-1 gene:ENSCJAG00000000477 transcript:ENSCJAT00000000859 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRAHPEYSSSDSELDETIEVEKESADENGNLSSALGSMSPTTSSQILARKRRRGIIEKR
RRDRINNSLSELRRLVPSAFEKQVMEQGSAKLEKAEILQMTVDHLKMLHTAGGKGYFDAH
ALAMDYRSLGFRECLAEVARYLSIIEGLDASDPLRVRLVSHLNNYASQREAASGAHAGLG
HIPWGTAFGHHPHIAHPLLLPQNGHGNAGTTASPTESLHQGRLASAHPEAPALRAPPSGS
LGPVLPVVTSASKLSQPLLSSVASLSAFPFSFGSFHLLSPNALSPSAPTQATNLGKPYRP
WGTEIGAF
Download sequence
Identical sequences F6PYF0
XP_008981065.1.60252 ENSCJAP00000000804 ENSCJAP00000000819 ENSCJAP00000048892

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]