SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000001578 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000001578
Domain Number 1 Region: 7-94,132-158
Classification Level Classification E-value
Superfamily FKBP-like 6.87e-19
Family FKBP immunophilin/proline isomerase 0.0017
Further Details:      
 
Domain Number 2 Region: 174-300
Classification Level Classification E-value
Superfamily TPR-like 3.2e-18
Family Tetratricopeptide repeat (TPR) 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000001578   Gene: ENSCJAG00000000929   Transcript: ENSCJAT00000001678
Sequence length 330
Comment pep:known chromosome:C_jacchus3.2.1:11:123273138:123283177:1 gene:ENSCJAG00000000929 transcript:ENSCJAT00000001678 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADIIARLREDGIQKRVIQEGRGDLPDFQDGTKATFHYRTLHSDDEGTVLDDSRARGKPM
ELIIGKKFKLPVWETIVCTMREGEIAQFLCDIKHVVLYPLVAKSLRNIAAGKDPLEGQRH
CCGVAQMQEHSSLGHADLDALQQNPQPLIFHMEMLKVESPGTYQQDPWAMTDEEKAKAVP
LIHQEGNRLYREGHVKEAAAKYYDAIACLKNLQMKEQPGSSDWIRLDQQITPLLLNYCQC
KLVAQEYYEVLDHCSSILNKYDDNVKAYFKRGKAHAAVWNAREAQADFAKVLELDPALAP
VVSRELQALEARIRLKDEEDKARFRGIFSH
Download sequence
Identical sequences F6YY30
ENSCJAP00000001578 XP_002755632.1.60252 ENSCJAP00000001578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]