SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000023998 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000023998
Domain Number 1 Region: 309-554
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.7e-89
Family Eukaryotic proteases 0.0000325
Further Details:      
 
Domain Number 2 Region: 219-315
Classification Level Classification E-value
Superfamily SRCR-like 1.31e-18
Family Hepsin, N-terminal domain 0.024
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000023998
Domain Number - Region: 198-222
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000113
Family LDL receptor-like module 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000023998   Gene: ENSCJAG00000013052   Transcript: ENSCJAT00000025386
Sequence length 570
Comment pep:novel chromosome:C_jacchus3.2.1:11:15502134:15513339:-1 gene:ENSCJAG00000013052 transcript:ENSCJAT00000025386 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LNQSHKGRMSTLYTWFTRTVPGSSSDLNAPPARTSSARVSPAQASPAGTPPGQTSPGQSP
PARASPARASPARASPARASPTRASPAQTSASRSSSSRSSSARSASVTASPTRVYLVRAT
PVGAVPTRPSPARSAPAARATRESSGTSLPKFTWREGQKRLPLIGCVLLLITLVVSLIIL
FHFWRGHTGIRYKEQRESCPKHAVRCDGVVDCKLKSDELGCVRFDWDKSLLKIYSESSHQ
WLPICSSNWNDSYSEKTCQQLGFESAYRTTEVAHRDFANSFSISRYNSTIQESLHRSECP
SQRYISLQCSHCGLRAMTGRIVGGALASESKWPWQVSLHFGTTHICGGTLIDAQWVLTAA
HCFFVTREKILEGWKVYAGTSNLHQLPEAASIAEIIINSNYTDEQDDYDIALMRLSKPLP
LSAHIHPACLPMHGQTFSLNETCWITGFGKTRETDDKTSPFLREVQVNLIDFKRCNDYLV
YDSYLTPRMMCAGDLRGGRDSCQGDSGGPLVCEQNNRWYLAGVTSWGTGCGQRNKPGVYT
KVTEVLPWIYSKMEVRALHWDTALSSLGTS
Download sequence
Identical sequences F7EFH1
ENSCJAP00000023985 ENSCJAP00000023998

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]