SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000027829 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000027829
Domain Number 1 Region: 196-490
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase FAD-binding domain 1.14e-95
Family Cryptochrome/photolyase FAD-binding domain 0.0000159
Further Details:      
 
Domain Number 2 Region: 5-214
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase, N-terminal domain 1.96e-54
Family Cryptochrome/photolyase, N-terminal domain 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000027829   Gene: ENSCJAG00000015099   Transcript: ENSCJAT00000029408
Sequence length 587
Comment pep:novel chromosome:C_jacchus3.2.1:9:97005181:97016507:-1 gene:ENSCJAG00000015099 transcript:ENSCJAT00000029408 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVNAVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFAGSSNVGINRWRFLLQCLE
DLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKKLATEA
GVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLISKMEPLEIPVETITSEVIEKCTT
PLSDDHDEKYGVPSLEELGFDTDGLSSAVWPGGETEALTRLERHLERKAWVANFERPRMN
ANSLLASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLLWREFFYTAA
TNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEGWIHHLARHA
VACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFHCYCPVGFGR
RTDPNGDYIRRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMVNHAEASRL
NIERMKQIYQQLSRYRGLGLLASVPSNPNGNGGFMGYSAENIPGCTSSGSCSQGSGILHC
AHGDSQQTHLLKQGRSSMSTGISGGKRPSQEEDTQSIGPKVQRQSTN
Download sequence
Identical sequences F7FRW9
ENSCJAP00000027829 ENSCJAP00000027870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]