SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000028070 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000028070
Domain Number 1 Region: 52-101
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 1.7e-18
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.0000919
Further Details:      
 
Domain Number 2 Region: 3-53
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 7.85e-18
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.0000867
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000028070   Gene: ENSCJAG00000015225   Transcript: ENSCJAT00000029661
Sequence length 110
Comment pep:known scaffold:C_jacchus3.2.1:GL285463.1:1891:11048:-1 gene:ENSCJAG00000015225 transcript:ENSCJAT00000029661 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINSALAQRVRNRVNFRG
ALNTYRFCDNVWTFVLNDVEFREVTELIKVEKVKIVACDGKSGYISNDTQ
Download sequence
Identical sequences H9KX43
ENSCJAP00000028070 ENSCJAP00000028070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]