SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000028495 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000028495
Domain Number 1 Region: 133-244
Classification Level Classification E-value
Superfamily S13-like H2TH domain 1.62e-26
Family Middle domain of MutM-like DNA repair proteins 0.00000265
Further Details:      
 
Domain Number 2 Region: 2-130
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 3.27e-25
Family N-terminal domain of MutM-like DNA repair proteins 0.000000419
Further Details:      
 
Domain Number 3 Region: 248-290
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.99e-19
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.0000802
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000028495   Gene: ENSCJAG00000015471   Transcript: ENSCJAT00000030110
Sequence length 385
Comment pep:novel chromosome:C_jacchus3.2.1:10:17575375:17582501:1 gene:ENSCJAG00000015471 transcript:ENSCJAT00000030110 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEGPELHLASQFVNEACRALVFGGCVEKSSVSRNPEVPFESSAYRISASARDKELRLTL
SPLPGAQPPQEPLALVFRLGMSGSFQLVPRGELLRHAHPSFYTALPSPRLALCFVDIRRV
GHWDLGGKWQPGRGPCVLQELCPSRENVLRNLSDKAFDRPICEALLDQRFFNGIGNYLRA
EILYRLKIPPFKKARSVLEALQQRRPSPELTLSQKIKAKLQNPDLLELCHSVPKEVVQLG
GKGYGSESGEEDFAAFRAWLRCYGMPGMSSLQDRHGRTIWFQGDPGPLAPKGKLLLIKKS
KVTQPSPEDGVEDRPPPSKAPSRTLRAKRDLPERTATQRPEATSFQQDPEALKIPKKGRR
KGCQRRPRKAKADTPSLELEGTSAS
Download sequence
Identical sequences F6UGH3
ENSCJAP00000028495 ENSCJAP00000028495

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]