SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000035912 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000035912
Domain Number 1 Region: 75-169
Classification Level Classification E-value
Superfamily PDZ domain-like 8.15e-30
Family PDZ domain 0.01
Further Details:      
 
Domain Number 2 Region: 1-52
Classification Level Classification E-value
Superfamily L27 domain 1.29e-19
Family L27 domain 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000035912   Gene: ENSCJAG00000019343   Transcript: ENSCJAT00000037924
Sequence length 206
Comment pep:known chromosome:C_jacchus3.2.1:9:70632834:70733168:-1 gene:ENSCJAG00000019343 transcript:ENSCJAT00000037924 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DVARAIELLEKLQESGEVPVHKLQSLKKVLQSEFCTAIREVYQYMHETITVNGCPEFRAR
ATAKATVAAFAASEGHSHPRVVELPKTDEGLGFNVMGGKEQNSPIYISRIIPGGVAERHG
GLKRGDQLLSVNGVSVEGEHHEKAVELLKAAKDSVKLVVRYTPKVLEEMEARFEKLRTAR
RRQQQQLLIQQQQQQQQQQTQQNHMS
Download sequence
Identical sequences A0A091D1U0 F1PLC3 F7FZ11 G7N7R4 G7PIK3
ENSCJAP00000035912 ENSCAFP00000008700 ENSCJAP00000035912 ENSCAFP00000008700

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]