SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000038670 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000038670
Domain Number 1 Region: 59-104
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000301
Family HLH, helix-loop-helix DNA-binding domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000038670   Gene: ENSCJAG00000020787   Transcript: ENSCJAT00000040850
Sequence length 146
Comment pep:known chromosome:C_jacchus3.2.1:5:5706159:5707285:-1 gene:ENSCJAG00000020787 transcript:ENSCJAT00000040850 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVASGSCALKAGKTAGGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQQVNVLLYDM
NGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTAGGRGLPVRAPL
STLNGEISALTAEAACVPADDRILCR
Download sequence
Identical sequences F7IT16
ENSCJAP00000038670 ENSCJAP00000038670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]