SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000041453 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000041453
Domain Number 1 Region: 10-181
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.29e-43
Family G proteins 0.0000232
Further Details:      
 
Domain Number 2 Region: 189-227
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000000615
Family SOCS box-like 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000041453   Gene: ENSCJAG00000022882   Transcript: ENSCJAT00000043867
Sequence length 278
Comment pep:known chromosome:C_jacchus3.2.1:X:91774016:91775043:1 gene:ENSCJAG00000022882 transcript:ENSCJAT00000043867 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAPGSPDQAYDFLLKFLLVGDSDVGKGEILESLQDGAAESPYSHLAGIDYKTTTILLDG
QRVKLKLWDTSGQGRFCTIFRSYSRGAQGVILVYDIANRWSFEGMDRWIKKIDEHAPGVP
KILVGNRLHLAFKRQVPREQAQAYAERLGVTFFEVSPLCNFNIIESFTELARIVLLRHRL
NWLGRPSKVLSLQDLCCRAIVSYTPVHLVDKLPLPIALRSHLKSFSMAKGLNARMMRGLS
YSLTASSTHNRNSLCKMKIVCPPRSPPKNCTRNSCKIS
Download sequence
Identical sequences F7HAE8
ENSCJAP00000041453 ENSCJAP00000041453 XP_008987914.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]