SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000044521 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000044521
Domain Number 1 Region: 237-529
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase FAD-binding domain 1.44e-95
Family Cryptochrome/photolyase FAD-binding domain 0.0000121
Further Details:      
 
Domain Number 2 Region: 44-225
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase, N-terminal domain 1.31e-54
Family Cryptochrome/photolyase, N-terminal domain 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000044521   Gene: ENSCJAG00000011551   Transcript: ENSCJAT00000052258
Sequence length 614
Comment pep:novel chromosome:C_jacchus3.2.1:11:108862177:109085197:1 gene:ENSCJAG00000011551 transcript:ENSCJAT00000052258 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VGGVRGAYPGGAGVAGAVWTVMAATVATAAAAVPAPAPGTDGASSVHWFRKGLRLHDNPA
LLAAVRGARCVRCVYILDPWFAASSSVGINRWRFLLQSLEDLDTSLRKLNSRLFVVRGQP
ADVFPRLFKEWGVTRLTFEYDSEPFGKERDAAIMKMAKEAGVEVVTENSHTLYDLDRIIE
LNGQKPPLTYKRFQAIISRMELPKKPVGSVTSQQMESCRAEIQENHDETYGVPSLEELGF
PTEGLGPAVWQGGETEALARLDKHLERKAWVANYERPRMNANSLLASPTGLSPYLRFGCL
SCRLFYYRLWDLYKKVKRNSTPPLSLFGQLLWREFFYTAATNNPRFDRMEGNPICIQIPW
DRNPEALAKWAEGKTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWVSWESGVRV
FDELLLDADFSVNAGSWMWLSCSAFFQQFFHCYCPVGFGRRTDPSGDYIRRYLPKLKGFP
SRYIYEPWNAPESIQKAAKCIIGVDYPRPIVNHAETSRLNIERMKQIYQQLSRYRGLCLL
ASVPSCVEDLSHPVAEPSSSQAGSMSSAGPRPLPSGPASPKRKLEAAEEPPGEELSKRAR
VAELPTPELPSKDV
Download sequence
Identical sequences F6RC87
ENSCJAP00000021244 ENSCJAP00000044521

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]