SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000044608 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000044608
Domain Number 1 Region: 5-207
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 1.6e-50
Family D-ribulose-5-phosphate 3-epimerase 0.00000296
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000044608   Gene: ENSCJAG00000010822   Transcript: ENSCJAT00000063183
Sequence length 230
Comment pep:novel chromosome:C_jacchus3.2.1:6:126144406:126156941:1 gene:ENSCJAG00000010822 transcript:ENSCJAT00000063183 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGCKIGPSILNSDLANLGAECLRMLDSGADYLHLDVMDGHFVPNITFGHPVVESLRKQ
LGQDPFFDMHMMVSKPEQWVKPMAIAGANQYTFHLEATENPGALIKDIRENGMKSCSFAQ
AKVQWPSQGPLQVGLAIKPGTSVEYLAPWANQIDMALVMTVEPGFGGQKFMEDMMPKVHW
LRTQFPSLDIEVDGGVGPDTVHKCAECSGQIPLWLYLCHTFLLDIYLSKT
Download sequence
Identical sequences F7ECN1
ENSCJAP00000044608 ENSCJAP00000044608

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]