SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000050489 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000050489
Domain Number 1 Region: 390-683
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.94e-57
Family Quinoprotein alcohol dehydrogenase-like 0.019
Further Details:      
 
Domain Number 2 Region: 61-305
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.97e-34
Family WD40-repeat 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000050489   Gene: ENSCJAG00000005304   Transcript: ENSCJAT00000054106
Sequence length 1322
Comment pep:novel chromosome:C_jacchus3.2.1:3:13406906:13536820:-1 gene:ENSCJAG00000005304 transcript:ENSCJAT00000054106 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWMTYISNWFDQDDWYEGLQRANMSQVRQVGLLAAGCQPWNRDVCAAGGDRFAYCATLA
IYIYQLDHRYNEFKLHAIMSEHKKTITAISWCPHNPDLFASGSTDNLVIIWNVAEQKVIA
KLDSTKGIPASLNWSWNADDVVAFVSHRGPLFIWTISGPDSGVTVHKEAHSFLSDICVFR
WHTHTKGKVAFGHMDGSLSIFQPGNKNQKHVLRPESREGTDEEDPVTALEWDPLSTDYLL
VVNLHYGIRLVDSESLSCITTFNLPSAAASVQCLAWVPSAPGMFVTGDSQVGVLRIWNVS
RTTPIDNLKLKKTGFHCLHVLNSPPRKKFSVQSPAKNHYTSSTSEAVPPPTLTQNQACSL
PPGHAVCCFLDGGVGLYDMGAKKWDFLRDLGHVETIFDCKFKPDDPNLLATASFDGTIKV
WDINTLTAVYTSPGNEGVIYSLSWAPGGLNCIAGGTSRNGAFIWNVQKGKIIQRFNEHGT
NGIFCIAWSHKDSKRIATCSNDGFCIIRTIDGKVLHKYKHPAAVFGCDWSQNNKDMIATG
CEDTNVRVYYVATSSDQPLKVFSGHTAKVFHVKWSPLREGILCSGSDDGTVRIWDYTQDA
CISILTGHTAPVRGLMWNTEIPYLLVSGSWDYTIKVWDTREGTCLDTVYDHGADVYGLTC
HPSRPFTMASCSRDSTVRLWSLTPLITPVQINILADRSWEEIMGNTDYAIEPGTPPLLCG
KVSRDIRQEIEKLTGNSQMKKLRWFSECLSPPGGSDNVWNLVAVLKGQDDSLLPQNYCKG
IMHLKHLVKFRTSEAQELTTVKMSKFGGGIGVPTKEERLKEAAEIHLRLGQIQRYCELMV
ELGEWDKALSIAPGVSVKYWKKLMQRRADQLIQEDKDDVIPYCIATGDVKKLVHFFVSRG
QLKEALLVAQAACEGNMQTLHVSTPNGASCSDDTYKEDFNEPLQAVSKELAEWYFQDGRA
ALAACCHLAIDNIELAMAYLIRGNELELAVCVGTVLGESAAPATHYALELLARKCMMISV
CVGNARYSTSFCYVNRNLAADLLLMIPDNELHLIKLCAFYPGCTEEINDLHDKCKLPTVE
ECMQLAETAHADDNIFETVKYYLLSQEPEKALPIGISFVKEYISSSDWTLDTIYPVLDLL
SYIRTEKLLLHTYTEARNELLILCGYIGALLAIRRQYQSIVPALYEYTSQLLKRREVSVP
LKIEYLSEELGAWRACTQSTNRSLEDSPYTPPSDSQRMVYATLLKRLTEESLKGIIGPDY
VTGSNLPSHSDTHISCLTGLKIQGPVFFLEDGKSAISLNDALMWAKVNPFSPLGTGIRLN
PF
Download sequence
Identical sequences F7FJV2
ENSCJAP00000009817 ENSCJAP00000050489

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]