SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Catan1|144323|estExt_Genewise1.C_1940006 from Catenaria anguillulae PL171 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Catan1|144323|estExt_Genewise1.C_1940006
Domain Number 1 Region: 112-506
Classification Level Classification E-value
Superfamily PLP-dependent transferases 9.95e-108
Family GABA-aminotransferase-like 0.0000000107
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Catan1|144323|estExt_Genewise1.C_1940006
Sequence length 558
Sequence
MEALLSSVTTKCPFLHRSSVATLKTLAANTQGLTRPGESGLTKVAAACPIMSKAISQHRQ
LHSTPQRNSAYPLHGFPSAQQQAPAAPTPAPEAAKDMAKEAAATGTGNSKPFHYDNFFAE
QLEKKKRDKSYRYFNNINRLAQAYPAAHTGSGDHVTVWCANDYLGMSRHPVVTDAMKRAV
DTYGAGAGGTRNIAGNAALHLRLEHALADLHNVDAALVFSSCFVANDATLCTLASKMPGT
HIFSDASNHASMIQGIRNSRAHKHVFRHNDVAHLEEQLQKVPLEAPKIIAFESVYSMCGS
IGPIKDFIRLAKKYNALTFLDEVHAVGMYGHRGAGVAEYQDLMSHIDIITGTLGKAFGVV
GGYIAGNANLVDMIRSYAPGFIFTTSLPPPVVAGALASVEYLKESRLERSGQQLNTRDLK
ARLAQVGIPVVPNPSHIVPVLVGDAELAKRVSDDLLRDHAIYVQSINSPTVSVGEERLRI
TPTPGHTPAMMDELVDSLLKLWKKHDLKFEKDWELAPRANVGTGVQVEQLVKMEDLVVPA
PYLNARAENRPMLVPASV
Download sequence
Identical sequences jgi|Catan1|144323|estExt_Genewise1.C_1940006

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]