SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Catan1|36244|fgenesh1_kg.20_#_28_#_Locus6609v1rpkm19.06 from Catenaria anguillulae PL171 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Catan1|36244|fgenesh1_kg.20_#_28_#_Locus6609v1rpkm19.06
Domain Number 1 Region: 5-104
Classification Level Classification E-value
Superfamily Cap-Gly domain 5.11e-26
Family Cap-Gly domain 0.00028
Further Details:      
 
Domain Number 2 Region: 405-637
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000000137
Family Tropomyosin 0.0044
Further Details:      
 
Domain Number 3 Region: 648-832
Classification Level Classification E-value
Superfamily Tropomyosin 0.000085
Family Tropomyosin 0.0034
Further Details:      
 
Weak hits

Sequence:  jgi|Catan1|36244|fgenesh1_kg.20_#_28_#_Locus6609v1rpkm19.06
Domain Number - Region: 844-1006
Classification Level Classification E-value
Superfamily Tropomyosin 0.00477
Family Tropomyosin 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Catan1|36244|fgenesh1_kg.20_#_28_#_Locus6609v1rpkm19.06
Sequence length 1116
Sequence
MSRQQQQVQVGDSVIVPATGQTGVLRFLGPVHFRPGVWAGVQLDAVGTGKNNGAVAGVAY
FACPPDTGLFVPAEKVQAVAPARQPHATQQQPRTPARTPARTPVRPTPMRPSPGPAQGQS
NYGHTSAPLATANAHGRPSQRVSTSSTDSSMSSSQQHRTRSGGLTPGSARMTSATTPSRS
GVPPRTPSMSRSSASRGVSTSRMPGFNTNDAGATPNASRASVSDRRRSMSPSPAATFASA
RQRKALSINPAAPPAPEPVGQPTKRLTLSFSRPSSMNGDDPNASFNHAFPTPPMPDSLDA
FSRHLEHHGAAPESGDQHSQVRPAEDAYAIQDLRNKVEELLAENRMLKLDSATRAVSGVL
SNEEREELDVKIKDLEAQLAHATLAKDVAVAEMQVSHSKQVEALEQALSELQSALAEKSR
TLNEQAETITQFQVELSSRTIMASELDDISQTISVLETEAQQKHQQAARFEAELATALQD
LKAARDSFAAMERDKRRVEAESDRYKARIGVLERELQSSTSTMDEFMKMGEDRVATFGKL
HGELKSKSDRIETLTMELDKRQEMLNRTQSLLDEVTATAQASAQDVQRLTSRVKELESER
DAMAQARDGKASDLQKLQAQFDQVTADLIDVQTKLAKANEECAVIPQLQDEIESLRRRDD
QKRVLVSSLETQLGHANESKAEMEQVLADKTRQLASLDRDLSSKKQLIDQLQSEIDSVTS
TASQLEHKTLSQTQQLKRLESQLEARSAALAAAENDLTDCQKKVTLLEQAVKGREGLQEK
IAEMQAQFDSDKARLTQQLQNQISSLQRDLEASRTESSDLAAQLQSHLDDLSVAKALALS
RAQDLGEAKHVIADMEQSLASSQARSTSLHEQLVTLRQAQEKLQDEYAQVLARNSELGSA
RGQLSVAEAKVQELTKHVAQQEAKNEALEKAVEDFKKQVASKDSQGSSVQARVVELEASL
AEASAALIAKEQELKEMQGKVSHLKQSRRETMAQYMDSIDTLMADMMRLQAKYDEVTSKP
ADPNRLSTQSTPAPDSDRDEVVSNNHRMSMPVSGDSLDFSAPPRGSSRMRSQSVQGPSPR
SSGASFDMKPVTVHDLPESYLHSFPGVPTSPNQLEE
Download sequence
Identical sequences jgi|Catan1|36244|fgenesh1_kg.20_#_28_#_Locus6609v1rpkm19.06

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]