SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Catan1|42092|fgenesh1_kg.107_#_10_#_Locus8666v1rpkm11.06 from Catenaria anguillulae PL171 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Catan1|42092|fgenesh1_kg.107_#_10_#_Locus8666v1rpkm11.06
Domain Number 1 Region: 878-1086
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000134
Family Tropomyosin 0.0027
Further Details:      
 
Domain Number 2 Region: 643-704
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000206
Family Tropomyosin 0.0044
Further Details:      
 
Weak hits

Sequence:  jgi|Catan1|42092|fgenesh1_kg.107_#_10_#_Locus8666v1rpkm11.06
Domain Number - Region: 641-845
Classification Level Classification E-value
Superfamily Tropomyosin 0.00235
Family Tropomyosin 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Catan1|42092|fgenesh1_kg.107_#_10_#_Locus8666v1rpkm11.06
Sequence length 1575
Sequence
MSGSASGSGPGPGPDPSASGPDPPTPAARSAAGDVGTERDQDLGPHAEARPLSPLAVAVA
ARRTPSPDSESLSQHQQPTLVIPRPRPASGPSNVFSPNSSLYSAAAINTPLPDSPYSHGA
SALGHPGNSSLLALGPSADQHQHQHSSSPSVSPSDDGDDHVLHMSDSPTSFSDHTHFHLP
TTGAHESTNNNDNDDHDAGEATELSFISGNDLSSHSHVQPRHQSHQSHSHPKSHSRSHSN
PAATTVAPATDTASLLGNNPTDPQTLAHFRTHLAHLHTHLSASTSHSATLRSQLDEAHAH
IARQREQHAHELDRVHRELARSHAQHTREMHLATETLASLKMALAAAEGERDQVADENVG
MARRLQDVLDRLAGLEDENAKLNKQLTDQRQLIQAQPPQQQQQQQQQQQQQQQKDWKARA
STAERASAQLAEDLAHAKSELASATARVAAAEGERDQLVCAMGAKSDMHCEELARIEAHV
RELQAAVDRERGQGETVRRALDEALAQVAELRSRELDLADKLKAAEKERDVCLQDNRDLV
EQMKEWKDRAKEMAGKAAELEKEVETLRAQAELRAVDDAAADDKSMESEVHEDPSALTTR
SLPATLSSPMDHPLVANLHEDRQRLQDALAASRATANAHASALQSQLDAAQERAQAAEEN
VASLERELDSAHTLVHQLESELEKLHDDLDTLRNQLQDQQQQVAQPPPPPMRRNSSSTSS
IPASELNDLMRQLRSAETDRQHMQDRLSVVTGQSAAVMERLELVTRERDDARVHATALNT
TAEELRAQLEDALAKAMQSDEWMQQAEARGREVKEVRRELDEALERVARLERQCADAAAT
MAAARDAVAGMYSGDDGDDDRAKQRTAAELRAEYEEEMAQLHDEIRMLNAELDQALAQRD
DAKRAAERAGNRAQRAEQEKVDLNRELAAAQAVVREAERNLEQIERMHQMERALGETEEQ
RDAAVERAEELAARADQLEADLCSVSGRVADLTAENGQLTVDCEQMRKQVTEISQDFALA
RDELEHLRDVKLRLDEVEEQLKGATQELEDTKANLETAVREKLLAQAQVTEAQNQAALAT
RRARTASSSQSNLIGPASPARGGGSGSGSVSFNSASMTALIAERDTQLKQLQAQYEEVVS
QFRSVAAKSAAMKRAVSSKMQQLEDREREAHASQLQFVALEKAYLDKIEGLHQTIAQLRN
AGGLTSGRDAVGGMVGSGDISEMGYASTIEDGAGGIRLAPMAREIERLRDQLHERDLALM
ERESSLEKMRTELVCMQHEVDRLRRERDMWQQSTTAPPPQSAMTATAASPRRGSTSIGST
SMRSTTSKRGSTPAPAVSDESLRQMAQALTELKREYTQRVAERDELEAKISKERKYFAKL
QAEANSDRARLQAKISELLTSPPSSAGGATHAAGGETALSANTTVVGPGASGLEARVNKY
RAKYVREAMMRAALIQQKAYLTSVLRTYKQSEETSWRLIQDLGIPRPSHRPGLMASGDPR
SALRTAIFAVRATIRIRNLHTFSAKAVAAAVSRPASGLGTPGTASRPTSFTSALTTGERS
GSAGALAALVGGGRR
Download sequence
Identical sequences A0A1Y2H8R8
jgi|Catan1|42092|fgenesh1_kg.107_#_10_#_Locus8666v1rpkm11.06

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]